IEC 63563-11:2025
(Main)Qi Specification version 2.0 - Part 11: MPP Communications Protocol
Qi Specification version 2.0 - Part 11: MPP Communications Protocol
IEC 63563-11:2025 describes Magnetic power profile (MPP) which is a protocol extension that provides additional messages, new power states/modes, new power transfer contract elements, and aims to provide the following functionalities:
• Operating Frequency Negotiation
• Cloaking (Power Pause)
• Generic Information Exchange
• Simultaneous Data Stream Transactions
• Fast PTx to PRx communication
• Maximum Power and Power Control Profiles Determination
• Extended Power Negotiation
• Extended PTx/PRx Identification and Capabilities
• Extended Control Error Packets and Received Power Packets
• Power Transmitter Battery Level Reporting
• Ecosystem Scalability
MPP extension allows devices to operate under Restricted mode (no PTx communication) at 360kHz without performing any explicit negotiation with the Power Transmitter. This flexibility enables devices with limited resources (e.g., devices with no FSK support) to take advantage of the frequency change feature.
Spécification Qi version 2.0 - Partie 11 : Spécification du système MPP
IEC 63563-11:2025 fournit une extension de protocole qui fournit des messages supplémentaires, de nouveaux états/modes de puissance, de nouveaux éléments de contrat de transfert de puissance, et vise à fournir les fonctionnalités suivantes:
• Négociation de la fréquence de fonctionnement
• Occultation (pause de puissance)
• Échange d'informations génériques
• Transactions simultanées de flux de données
• Communication rapide de PTx à PRx
• Détermination de la puissance maximale et des profils de contrôle de la puissance
• Négociation de pouvoir élargie
• Identification et capacités PTx/PRx étendues
• Paquets d'erreurs de contrôle étendus et paquets de puissance reçus
• Rapport sur le niveau de la batterie de l'émetteur de puissance
• Évolutivité de l'écosystème
L'extension MPP permet aux appareils de fonctionner en mode restreint (pas de communication PTx) à 360 kHz sans effectuer de négociation explicite avec l'émetteur de puissance. Cette flexibilité permet aux appareils disposant de ressources limitées (par exemple, les appareils ne prenant pas en charge la MDF) de tirer parti du phénomène de changement de fréquence.
General Information
- Status
- Published
- Publication Date
- 09-Feb-2025
- Technical Committee
- TA 15 - Wireless Power Transfer
- Drafting Committee
- WG 1 - TC 100/TA 15/WG 1
- Current Stage
- PPUB - Publication issued
- Start Date
- 10-Feb-2025
- Completion Date
- 07-Mar-2025
Overview
IEC 63563-11:2025 - Qi Specification version 2.0, Part 11: MPP Communications Protocol defines the Magnetic Power Profile (MPP) extension for Qi wireless power systems. The MPP extension adds messaging, power states/modes, and contract elements to enable more flexible and scalable magnetic wireless power transfer between Power Transmitters (PTx) and Power Receivers (PRx). It supports enhanced negotiation, data exchange, and control capabilities while preserving a low‑resource operating option (Restricted mode at 360 kHz) for devices without full FSK/FMCW support.
Key topics and technical requirements
The standard expands core Qi behavior with the following technical areas and requirements:
- Operating Frequency Negotiation - mechanisms for agreeing on frequency changes between PTx and PRx.
- Cloaking (Power Pause) - defined states and messages to temporarily pause power transfer for safe events or coexistence.
- Generic Information Exchange - generic packets for capability and status sharing.
- Simultaneous Data Stream Transactions - support for parallel data channels alongside power control.
- Fast PTx → PRx Communication - low‑latency signaling to accelerate control and responses.
- Maximum Power & Power Control Profiles Determination - profiles and messages to determine and enforce power limits and control behaviors.
- Extended Power Negotiation - richer negotiation elements and contracts for dynamic scenarios.
- Extended Identification & Capabilities - enhanced PTx/PRx IDs and reported capabilities for interoperability.
- Extended Control Error Packets & Received Power Packets - improved telemetry and control feedback.
- Power Transmitter Battery Level Reporting - PTx-side battery/state reporting to inform PRx behavior.
- Ecosystem Scalability - provisions to scale multi‑device, multi‑transmitter systems.
The specification organizes behavior into phases such as Negotiation, Power Transfer, Cloak, and Extended Data Streams (see table of contents for phase‑level requirements).
Applications and who uses it
This standard is intended for:
- Wireless power system designers (PTx/PRx hardware and firmware teams) implementing advanced negotiation and control features.
- Product teams building multi-device charging mats, wearables, IoT endpoints, and consumer electronics that need robust coexistence, frequency management, or low‑resource receiver options.
- Certification and test labs validating compliance and interoperability across the Qi ecosystem.
- Ecosystem integrators and OEMs aiming for scalable multi‑transmitter/receiver deployments and better power management.
Practical uses include enabling constrained devices to benefit from frequency changes via Restricted mode (360 kHz), improving multi‑device simultaneous charging, enabling fast control loops for responsive power delivery, and exposing transmitter state (battery/health) to receivers.
Related standards
- Base Qi Specification version 2.0 (core wireless power definitions)
- Other parts of the IEC 63563 series covering device/system requirements and interoperability
For authoritative text and purchase, obtain IEC 63563-11:2025 from the IEC Webstore.
Buy Documents
IEC 63563-11:2025 - Qi Specification version 2.0 - Part 11: MPP Communications Protocol Released:2/10/2025
IEC 63563-11:2025 - Spécification Qi version 2.0 - Partie 11 : Spécification du système MPP/10/2025
IEC 63563-11:2025 - Qi Specification version 2.0 - Part 11: MPP Communications Protocol/10/2025
Get Certified
Connect with accredited certification bodies for this standard

BSI Group
BSI (British Standards Institution) is the business standards company that helps organizations make excellence a habit.

IMQ S.p.A. (Certification)
Italian electrical product certification.

SLG Prüf- und Zertifizierungs GmbH
German testing and certification body.
Sponsored listings
Frequently Asked Questions
IEC 63563-11:2025 is a standard published by the International Electrotechnical Commission (IEC). Its full title is "Qi Specification version 2.0 - Part 11: MPP Communications Protocol". This standard covers: IEC 63563-11:2025 describes Magnetic power profile (MPP) which is a protocol extension that provides additional messages, new power states/modes, new power transfer contract elements, and aims to provide the following functionalities: • Operating Frequency Negotiation • Cloaking (Power Pause) • Generic Information Exchange • Simultaneous Data Stream Transactions • Fast PTx to PRx communication • Maximum Power and Power Control Profiles Determination • Extended Power Negotiation • Extended PTx/PRx Identification and Capabilities • Extended Control Error Packets and Received Power Packets • Power Transmitter Battery Level Reporting • Ecosystem Scalability MPP extension allows devices to operate under Restricted mode (no PTx communication) at 360kHz without performing any explicit negotiation with the Power Transmitter. This flexibility enables devices with limited resources (e.g., devices with no FSK support) to take advantage of the frequency change feature.
IEC 63563-11:2025 describes Magnetic power profile (MPP) which is a protocol extension that provides additional messages, new power states/modes, new power transfer contract elements, and aims to provide the following functionalities: • Operating Frequency Negotiation • Cloaking (Power Pause) • Generic Information Exchange • Simultaneous Data Stream Transactions • Fast PTx to PRx communication • Maximum Power and Power Control Profiles Determination • Extended Power Negotiation • Extended PTx/PRx Identification and Capabilities • Extended Control Error Packets and Received Power Packets • Power Transmitter Battery Level Reporting • Ecosystem Scalability MPP extension allows devices to operate under Restricted mode (no PTx communication) at 360kHz without performing any explicit negotiation with the Power Transmitter. This flexibility enables devices with limited resources (e.g., devices with no FSK support) to take advantage of the frequency change feature.
IEC 63563-11:2025 is classified under the following ICS (International Classification for Standards) categories: 29.240.99 - Other equipment related to power transmission and distribution networks; 35.240.99 - IT applications in other fields. The ICS classification helps identify the subject area and facilitates finding related standards.
IEC 63563-11:2025 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.
Standards Content (Sample)
IEC 63563-11 ®
Edition 1.0 2025-02
INTERNATIONAL
STANDARD
Qi Specification version 2.0 –
Part 11: MPP System Specification
All rights reserved. Unless otherwise specified, no part of this publication may be reproduced or utilized in any form
or by any means, electronic or mechanical, including photocopying and microfilm, without permission in writing from
either IEC or IEC's member National Committee in the country of the requester. If you have any questions about IEC
copyright or have an enquiry about obtaining additional rights to this publication, please contact the address below or
your local IEC member National Committee for further information.
IEC Secretariat Tel.: +41 22 919 02 11
3, rue de Varembé info@iec.ch
CH-1211 Geneva 20 www.iec.ch
Switzerland
About the IEC
The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes
International Standards for all electrical, electronic and related technologies.
About IEC publications
The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the
latest edition, a corrigendum or an amendment might have been published.
IEC publications search - webstore.iec.ch/advsearchform IEC Products & Services Portal - products.iec.ch
The advanced search enables to find IEC publications by a Discover our powerful search engine and read freely all the
variety of criteria (reference number, text, technical publications previews, graphical symbols and the glossary.
committee, …). It also gives information on projects, replaced With a subscription you will always have access to up to date
and withdrawn publications. content tailored to your needs.
IEC Just Published - webstore.iec.ch/justpublished
Electropedia - www.electropedia.org
Stay up to date on all new IEC publications. Just Published
The world's leading online dictionary on electrotechnology,
details all new publications released. Available online and once
containing more than 22 500 terminological entries in English
a month by email.
and French, with equivalent terms in 25 additional languages.
Also known as the International Electrotechnical Vocabulary
IEC Customer Service Centre - webstore.iec.ch/csc
(IEV) online.
If you wish to give us your feedback on this publication or need
further assistance, please contact the Customer Service
Centre: sales@iec.ch.
IEC 63563-11 ®
Edition 1.0 2025-02
INTERNATIONAL
STANDARD
Qi Specification version 2.0 –
Part 11: MPP System Specification
INTERNATIONAL
ELECTROTECHNICAL
COMMISSION
ICS 29.240.99; 35.240.99 ISBN 978-2-8327-0184-3
,(&‹,(&
INTERNATIONAL ELECTROTECHNICAL COMMISSION
____________
QI SPECIFICATION VERSION 2.0 –
Part 11: MPP System Specification
FOREWORD
The International Electrotechnical Commission (IEC) is a worldwide organization for standardization comprisingall
national electrotechnical committees (IEC National Committees). The object of IEC is to promote internationalco-
operation on all questions concerning standardization in the electrical and electronic fields. To this end andin addition
to other activities, IEC publishes International Standards, Technical Specifications, TechnicalReports, Publicly
Available Specifications (PAS) and Guides (hereafter referred to as “IEC Publication(s)”). Theirpreparation is entrusted to
technical committees; any IEC National Committee interested in the subject dealt withmay participate in this
preparatory work. International, governmental and non-governmental organizationsliaising with the IEC also
participate in this preparation. IEC collaborates closely with the InternationalOrganization for Standardization
(ISO) in accordance with conditions determined by agreement between the twoorganizations.
The formal decisions or agreements of IEC on technical matters express, as nearly as possible, an international
consensus of opinion on the relevant subjects since each technical committee has representation from all
interested IEC National Committees.
IEC Publications have the form of recommendations for international use and are accepted by IEC National
Committees in that sense. While all reasonable efforts are made to ensure that the technical content of IEC
Publications is accurate, IEC cannot be held responsible for the way in which they are used or for any
misinterpretation by any end user.
In order to promote international uniformity, IEC National Committees undertake to apply IEC Publications
transparently to the maximum extent possible in their national and regional publications. Any divergence betweenany IEC
Publication and the corresponding national or regional publication shall be clearly indicated in the latter.
IEC itself does not provide any attestation of conformity. Independent certification bodies provide conformity
assessment services and, in some areas, access to IEC marks of conformity. IEC is not responsible for any
services carried out by independent certification bodies.
All users should ensure that they have the latest edition of this publication.
No liability shall attach to IEC or its directors, employees, servants or agents including individual experts and
members of its technical committees and IEC National Committees for any personal injury, property damage orother
damage of any nature whatsoever, whether direct or indirect, or for costs (including legal fees) andexpenses
arising out of the publication, use of, or reliance upon, this IEC Publication or any other IECPublications.
Attention is drawn to the Normative references cited in this publication. Use of the referenced publications is
indispensable for the correct application of this publication.
IEC draws attention to the possibility that the implementation of this document may involve the use of (a)
patent(s). IEC takes no position concerning the evidence, validity or applicability of any claimed patent rights inrespect
thereof. As of the date of publication of this document, IEC had notreceived notice of (a) patent(s),which may be
required to implement this document. However, implementers are cautioned that this may notrepresent the latest
information, which may be obtained from the patent database available athttps://patents.iec.ch. IEC shall
not be held responsible for identifying any or all such patent rights.
IEC 635-11 has been prepared by technical area 15: Wireless Power Transfer, of IEC
technical committee 100: Audio, video and multimedia systems and equipment. It is an
International Standard.
It is based on Qi Specification version 2.0, MPP Communications Protocol and was submitted
as a Fast-Track document.
The text of this International Standard is based on the following documents:
Draft Report on voting
//FDIS //RVD
,(&‹,(&
Full information on the voting for its approval can be found in the report on voting indicated in
the above table.
The language used for the development of this International Standard is English.
The structure and editorial rules used in this publication reflect the practice of the organization
which submitted it.
This document was developed in accordance with ISO/IEC Directives, Part 1 and ISO/IEC
Directives, IEC Supplement available at www.iec.ch/members_experts/refdocs. The main
document types developed by IEC are described in greater detail at www.iec.ch/publications.
The committee has decided that the contents of this document will remain unchanged until the
stability date indicated on the IEC website under webstore.iec.ch in the data related to the
specific document. At this date, the document will be
x reconfirmed,
x withdrawn, or
x revised.
,(&‹,(&
WIRELESS POWER
CONSORTIUM
Yŝ^ƉĞĐŝĨŝĐĂƚŝŽŶ
DWWŽŵŵƵŶŝĐĂƚŝŽŶƐWƌŽƚŽĐŽů
sĞƌƐŝŽŶϮ͘Ϭ
ƉƌŝůϮϬϮϯ
,(&‹,(&
/^>/DZ
Ї‹ˆ‘”ƒ–‹‘…‘–ƒ‹‡†Š‡”‡‹‹•„‡Ž‹‡˜‡†–‘„‡ƒ……—”ƒ–‡ƒ•‘ˆ–Ї†ƒ–‡‘ˆ’—„Ž‹…ƒ–‹‘ǡ
„—–‹•’”‘˜‹†‡†Dzƒ•‹•dzƒ†ƒ›…‘–ƒ‹‡””‘”•ǤЇ‹”‡Ž‡••‘™‡”‘•‘”–‹—ƒ‡•‘
™ƒ””ƒ–›ǡ‡š’”‡••‘”‹’Ž‹‡†ǡ™‹–Š”‡•’‡…––‘–Š‹•†‘…—‡–ƒ†‹–•…‘–‡–•ǡ‹…Ž—†‹‰ƒ›
™ƒ””ƒ–›‘ˆ–‹–އǡ‘™‡”•Š‹’ǡ‡”…Šƒ–ƒ„‹Ž‹–›ǡ‘”ˆ‹–‡••ˆ‘”ƒ’ƒ”–‹…—Žƒ”—•‡‘”’—”’‘•‡Ǥ
‡‹–Ї”–Ї‹”‡Ž‡••‘™‡”‘•‘”–‹—ǡ‘”ƒ›‡„‡”‘ˆ–Ї‹”‡Ž‡••‘™‡”
‘•‘”–‹—™‹ŽŽ„‡Ž‹ƒ„އˆ‘”‡””‘”•‹–Š‹•†‘…—‡–‘”ˆ‘”ƒ›†ƒƒ‰‡•ǡ‹…Ž—†‹‰‹†‹”‡…–
‘”…‘•‡“—‡–‹ƒŽǡˆ”‘—•‡‘ˆ‘””‡Ž‹ƒ…‡‘–Їƒ……—”ƒ…›‘ˆ–Š‹•†‘…—‡–Ǥ ‘”ƒ›ˆ—”–Ї”
‡š’Žƒƒ–‹‘‘ˆ–Ї…‘–‡–•‘ˆ–Š‹•†‘…—‡–ǡ‘”‹…ƒ•‡‘ˆƒ›’‡”…‡‹˜‡†‹…‘•‹•–‡…›‘”ƒ„‹‰—‹–›
‘ˆ‹–‡”’”‡–ƒ–‹‘ǡ…‘–ƒ…–ǣ‹ˆ‘̷™‹”‡Ž‡••’‘™‡”…‘•‘”–‹—Ǥ…‘Ǥ
Z>^,/^dKZz
^ƉĞĐŝĨŝĐĂƚŝŽŶsĞƌƐŝŽŶ ZĞůĞĂƐĞĂƚĞ ĞƐĐƌŝƉƚŝŽŶ
Ϯ͘Ϭ ƉƌŝůϮϬϮϯ &ŝƌƐƚƌĞůĞĂƐĞŽĨƚŚŝƐǀϮ͘ϬƐƉĞĐŝĨŝĐĂƚŝŽŶ͘
,(&‹,(&
Contents
Contents 2
List of Tables 5
1 Introduction
2YHUYLHZ .
2 Magnetic Power Profile 1
2YHUYLHZ .
5HVWULFWHG0RGH .
)XOO0RGH .
3RZHU5HFHLYHU5HTXLUHPHQWV .
$PSOLWXGH6KLIW.H\LQJ$6. .
6WDUWXS%HKDYLRU .
3URILOH$FWLYDWLRQ .
3RZHU7UDQVPLWWHU5HTXLUHPHQWV .
)UHTXHQF\6KLIW.H\LQJ)6. .
7LPLQJV2YHUULGH .
6WDUWXS%HKDYLRU .
6XSSRUWLQJ(33DQG033SURWRFROV .
033(336XSSRUWRQ35[ .
033(336XSSRUWRQ37[ .
3 Negotiation Phase 2
2YHUYLHZ .
5HTXLUHPHQWV .
1HJRWLDWLRQ3KDVH7LPLQJV .
)6. &\FOHV .
(QWHULQJ1HJRWLDWLRQ3KDVH:LWK(UURU6WDWXV .
3RZHU7UDQVIHU&RQWUDFW([WHQVLRQ .
1HJRWLDWLRQ3KDVHN+] .
1RPLQDOQHJRWLDWLRQIORZ .
1HJRWLDWLRQIORZZLWK37[HUURUVWDWXV .
)UHTXHQF\6HOHFWLRQ .
1HJRWLDWLRQ3KDVHN+] .
35[([WHQGHG&DSDELOLWLHV .
37[([WHQGHG&DSDELOLWLHV .
([FKDQJH3RZHU/RVV$FFRXQWLQJ3DUDPHWHUV .
,(&‹,(&
3RZHU1HJRWLDWLRQ .
5HWULHYH37[([WHQGHG,' .
([FKDQJH(QDEOHG'DWD6WUHDPV .
3RZHU&RQWURO3URILOH .
&ORDNLQJ'XUDWLRQ .
0333URSULHWDU\5HTXHVWV3DFNHWV .
1)&,GHQWLILFDWLRQ,QIRUPDWLYH .
4 Power Transfer Phase 3
2YHUYLHZ .
([WHQGHG&RQWURO(UURU3DFNHW .
+DQGOLQJ .
37[5HVSRQVH .
([DPSOH .
3RZHU/RVV$FFRXQWLQJ3DFNHW .
+DQGOLQJ .
37[5HVSRQVH .
&RQWURO6WDWXV .
*(75HTXHVW .
35[,QLWLDWHG .
37[,QLWLDWHG .
([DPSOHV .
0335HVWULFWHGWR)XOOPRGH7UDQVLWLRQ .
7UDQVLWLRQZLWKSRZHULQWHUUXSWLRQ .
7UDQVLWLRQZLWKRXWSRZHULQWHUUXSWLRQ .
5 Cloak Phase 4
2YHUYLHZ .
&ORDN3LQJ5HTXLUHPHQWV .
&ORDN(QWU\ .
35[,QLWLDWHG .
37[,QLWLDWHG .
&ORDN([LW .
'HWHFWSLQJ .
6WDWH'LDJUDP .
&ORDN7LPLQJV .
([DPSOHV.
6 Extended Data Streams 5
2YHUYLHZ .
6LPXOWDQHRXV'DWD6WUHDP([WHQVLRQ .
(UURU+DQGOLQJ .
7LPLQJV .
&ORDNLQJ&RPSDWLELOLW\ .
'DWD,QWHJULW\([WHQVLRQ .
([DPSOHV.
7 Packets and Streams 6
3RZHU5HFHLYHUGDWDSDFNHWV .
&ORDN&/2$.[ .
([WHQGHG&RQWURO(UURU;&([ .
6SHFLILF5HTXHVW654[ .
,(&‹,(&
6SHFLILF5HTXHVW>)UHTXHQF\6HOHFWLRQ@654IUHTVHO[ .
6SHFLILF5HTXHVW>3RZHU/HYHO@654HJSO[ .
6SHFLILF5HTXHVW>&ORDN3LQJ'HOD\/RZ%\WH@654FORDNO[ .
6SHFLILF5HTXHVW>&ORDN3LQJ'HOD\+LJK%\WH@654FORDNK[ .
6SHFLILF5HTXHVW>3RZHU&RQWURO3URILOH@654SFS[ .
6SHFLILF5HTXHVW>&ORDN'HWHFW3LQJ'HOD\@654GHWHFW[ .
6SHFLILF5HTXHVW>3URSULHWDU\3DUDPHWHUV@6540SS3URS[ .
*HW5HTXHVW*(7[ .
(QDEOHG'DWD6WUHDPV('6[ .
6LPXOWDQHRXV$X[LOLDU\'DWD7UDQVSRUW6$'7PXOWLSOHKHDGHUFRGHV .
6LPXOWDQHRXV'DWD6WUHDP5HVSRQVH6'65[ .
6LPXOWDQHRXV$X[LOLDU\'DWD&RQWURO6$'&[ .
5HSRUW5(3257[.
5HSRUW>35[,GHQWLILFDWLRQ@[ .
3RZHU/RVV$FFRXQWLQJ[ .
3RZHU/RVV$FFRXQWLQJ3DUDPHWHUV3/$3[ .
4L033([WHQGHG,GHQWLILFDWLRQ033;,'[ .
([WHQGHG3RZHU5HFHLYHU&DSDELOLWLHV(&$3[.
3RZHU7UDQVPLWWHUGDWDSDFNHWV .
(UURU6WDWXV(55[ .
&ORDN5HTXHVW&/2$.[( .
5HJXODWLRQ&RQWURO6WDWXV5&6[( .
&KDUJH6WDWXV&+6[) .
*HW5HTXHVW*(7[( .
(QDEOHG'DWD6WUHDPV('6[) .
,QYHUWHU9ROWDJH,19[) .
6LPXOWDQHRXV$X[LOLDU\'DWD7UDQVSRUW6$'7PXOWLSOHKHDGHUFRGHV .
6LPXOWDQHRXV'DWD6WUHDP5HVSRQVH6'65[) .
(VWLPDWHG..(67[) .
6LPXOWDQHRXV$X[LOLDU\'DWD&RQWURO6$'&[) .
3RZHU/RVV$FFRXQWLQJ3DUDPHWHUV3/$3[) .
([WHQGHG3RZHU7UDQVPLWWHU,GHQWLILFDWLRQ;,'[) .
([WHQGHG3RZHU7UDQVPLWWHU([WHQGHG&DSDELOLWLHV(&$3[) .
,(&‹,(&
List of Tables
0336SHFLILFDWLRQV'HSDUWXUHIURP4L(33 .
033,'3DFNHW3DUDPHWHUV.
033)6.3DUDPHWHUV .
033)6.3DWWHUQV.
03337[3DUDPHWHUV2YHUULGH .
35[SDFNHWVDOORZHGGXULQJ033QHJRWLDWLRQSKDVH .
0331HJRWLDWLRQ3KDVH7LPLQJ3DUDPHWHUV.
0333RZHU7UDQVIHU&RQWUDFW(OHPHQWV .
033&RQWURO(UURU3DUDPHWHUV .
3RZHU/RVV$FFRXQWLQJ7LPLQJ3DUDPHWHUV .
37[,QLWLDWHG*(77LPLQJ3DUDPHWHUV .
0335HVWULFWHGWR)XOO7UDQVLWLRQ7LPLQJ3DUDPHWHUV .
&ORDN'HWHFW3DUDPHWHUV .
&ORDN7LPH3DUDPHWHUV .
'DWD6WUHDPV,GHQWLILHUV .
([WHQGHG'DWD6WUHDPV7LPLQJ .
'DWD6WUHDP&5&3URSHUWLHV .
03335[$6.3DFNHWV .
35[(QG2I3RZHU5HDVRQ&RGHV .
(QG2I3RZHU5HTXHVW)6.5HVSRQVHV .
([WHQGHG&RQWURO(UURU)6.5HVSRQVHV.
0336SHFLILF5HTXHVWV .
6SHFLILF5HTXHVW)UHTXHQF\6HOHFWLRQSDUDPHWHUV .
)UHTXHQF\6HOHFWLRQ5HTXHVW)6.5HVSRQVHV .
3RZHU/HYHO6HOHFWLRQ5HTXHVW)6.5HVSRQVHV .
&ORDN3LQJ'HOD\6HOHFWLRQ5HTXHVW654FORDNO)6.5HVSRQVHV .
&ORDN3LQJ'HOD\6HOHFWLRQ5HTXHVW654FORDNK)6.5HVSRQVHV .
3RZHU&RQWURO3URILOH9DOXHV .
3RZHU&RQWURO3URILOH6HOHFWLRQ5HTXHVW)6.5HVSRQVHV .
&ORDN'HWHFW3LQJ'HOD\6HOHFWLRQ5HTXHVW)6.5HVSRQVHV .
3URSULHWDU\6SHFLILF3DUDPHWHUV5HTXHVW)6.5HVSRQVHV .
35[*HW5HTXHVW7\SHV .
6LPXOWDQHRXV$X[LOLDU\'DWD7UDQVSRUW6$'7)6.5HVSRQVHV .
,(&‹,(&
35[6LPXOWDQHRXV'DWD6WUHDP5HVSRQVH7\SH .
6LPXOWDQHRXV$X[LOLDU\'DWD&RQWURO5HTXHVW)LHOG .
6LPXOWDQHRXV$X[LOLDU\'DWD&RQWURO3DUDPHWHU)LHOG .
5HSRUW,')LHOG.
5HSRUW>35[,GHQWLILFDWLRQ@)6.5HVSRQVHV .
3/$)6.5HVSRQVHV .
5HFHLYHG3RZHU3DUDPHWHUV)6.5HVSRQVHV .
35[&DSDELOLWLHV3DFNHW)6.5HVSRQVHV .
03337;)6.3DFNHWV .
37[(UURU6WDWXV&RGHV .
37[(QG2I3RZHU5HDVRQ&RGHV .
37[5HJXODWLRQ&RQWURO6WDWXV9DOXHV .
37[&KDUJH6WDWXV9DOXHV .
37[*HW5HTXHVW)LHOGV .
37[6LPXOWDQHRXV'DWD6WUHDP5HVSRQVH7\SH .
37[3RZHU/LPLW5HDVRQ&RGH .
,(&‹,(&
Introduction
1.1 Overview
0DJQHWLFSRZHUSURILOH033LVDSURWRFROH[WHQVLRQWKDWSURYLGHVDGGLWLRQDOPHVVDJHVQHZSRZHU
VWDWHVPRGHVQHZSRZHUWUDQVIHUFRQWUDFWHOHPHQWVDQGDLPVWRSURYLGHWKHIROORZLQJIXQFWLRQDOLWLHV
‡ 2SHUDWLQJ)UHTXHQF\1HJRWLDWLRQ
‡ &ORDNLQJ3RZHU3DXVH
‡ *HQHULF,QIRUPDWLRQ([FKDQJH
‡ 6LPXOWDQHRXV'DWD6WUHDP7UDQVDFWLRQV
‡ )DVW37[WR35[FRPPXQLFDWLRQ
‡ 0D[LPXP3RZHUDQG3RZHU&RQWURO3URILOHV'HWHUPLQDWLRQ
‡ ([WHQGHG3RZHU1HJRWLDWLRQ
‡ ([WHQGHG37[35[,GHQWLILFDWLRQDQG&DSDELOLWLHV
‡ ([WHQGHG&RQWURO(UURU3DFNHWVDQG5HFHLYHG3RZHU3DFNHWV
‡ 3RZHU7UDQVPLWWHU%DWWHU\/HYHO5HSRUWLQJ
‡ (FRV\VWHP6FDODELOLW\
$VXPPDU\RIGLIIHUHQFHVEHWZHHQ0DJQHWLF3RZHU3URILOHDQG(33LVOLVWHGEHORZLQ7DEOH
033H[WHQVLRQDOORZVGHYLFHVWRRSHUDWHXQGHU5HVWULFWHGPRGHQR37[FRPPXQLFDWLRQDWN+]ZLWKRXW
SHUIRUPLQJDQ\H[SOLFLWQHJRWLDWLRQZLWKWKH3RZHU7UDQVPLWWHU7KLVIOH[LELOLW\HQDEOHVGHYLFHVZLWKOLPLWHG
UHVRXUFHVHJGHYLFHVZLWKQR)6.VXSSRUWWRWDNHDGYDQWDJHRIWKHIUHTXHQF\FKDQJHIHDWXUH
,(&‹,(&
Table 1.1: 0336SHFLILFDWLRQV'HSDUWXUHIURP4L(33
Feature EPP MPP
37[+DQGVKDNH0HVVDJH (33)6.$&.0HVVDJH 033)6.$&.0HVVDJH
6HFWLRQ
)6.3DUDPHWHUV1HJRWLDWLRQ (33 DOORZV )6. SDUDPHWHUV )L[HG)6.SDUDPHWHUV
QHJRWLDWLRQ
'DWD6WUHDPV 6LQJOH6WUHDP7UDQVIHU 0XOWLSOH&RQFXUUHQW7UDQVIHU
)RUHLJQ2EMHFW'HWHFWLRQ )2'3DFNHW&DOLEUDWLRQ53 5HSODFHGZLWK0333RZHU/RVV
$FFRXQWLQJ3DFNHW
,(&‹,(&
Magnetic Power Profile
2.1 Overview
7KLVFKDSWHUGHVFULEHVWKH3RZHU5HFHLYHUDQG3RZHU7UDQVPLWWHUUHTXLUHPHQWVIRU0DJQHWLF3RZHU3URILOH
DQGWKHPRGHVGHYLFHVPD\XVHWRFRPPXQLFDWH
033VXSSRUWVWZRSURWRFROPRGHV
Restricted Mode2QHZD\FRPPXQLFDWLRQ35[WR37[ZLWKOLPLWHGSRZHUOHYHOV(5W PRECT) XVLQJ4L
%DVHOLQH3URWRFRO
Full Mode6XSSRUWVELGLUHFWLRQDOFRPPXQLFDWLRQDQGHQDEOHVQHJRWLDWLRQRIKLJKHUSRZHUOHYHOV
2.1.1 Restricted Mode
0335HVWULFWHGPRGHDOORZV35[WRHVWDEOLVKDFKDUJLQJVHVVLRQZLWK37[XVLQJRQHZD\FRPPXQLFDWLRQ
35[WR37[DWN+]RSHUDWLQJIUHTXHQF\XVLQJ4L%DVHOLQH3URWRFRO
37[DQG35[VKDOOIROORZWKH4L%DVHOLQH3URWRFROVSHFLILFDWLRQVZKHQRSHUDWLQJLQ5HVWULFWHGPRGH
(Informative)
0335HVWULFWHGPRGHFDQEHXVHGZKHQ35[LVRSHUDWLQJXQGHUDFRQVWUDLQHGHQYLURQPHQWHJGHYLFHLVIXOO\
GLVFKDUJHG
35[LVDOORZHGWRWUDQVLWLRQIURP0335HVWULFWHGWR033)XOOPRGHWRHQDEOHELGLUHFWLRQDOFRPPXQLFDWLRQ
DQGKLJKHUSRZHUOHYHOV5HIHUWR6HFWLRQIRUPRUHGHWDLOVRQKRZWRSHUIRUPWKHWUDQVLWLRQ
2.1.2 Full Mode
033)XOOPRGHHQDEOHVDFKDUJLQJVHVVLRQZLWKELGLUHFWLRQDOFRPPXQLFDWLRQEHWZHHQ37[DQG35[DOORZLQJ
GHYLFHVWRSHUIRUPPRUHFRPSOH[RSHUDWLRQVVXFKDVH[FKDQJHRILGHQWLILFDWLRQLQIRUPDWLRQGHYLFHV
FDSDELOLWLHVHFRV\VWHPVFDODELOLW\FRHIILFLHQWVSRZHUQHJRWLDWLRQDQGSHUIRUPDXWKHQWLFDWLRQ
,Q033)XOOPRGHGHYLFHVPD\WUDQVLWLRQEHWZHHQGLIIHUHQWSURWRFROSKDVHVVXFKDV1HJRWLDWLRQ3RZHU
7UDQVIHU&ORDNDQGDUHDEOHWRQHJRWLDWHKLJKHUSRZHUOHYHOVFRPSDUHGWR5HVWULFWHGPRGH
033)XOOPRGHLVEDVHGRQ4L([WHQGHG3RZHU3URILOH(33SURWRFRO37[DQG35[VKDOOIROORZWKH4L(33
VSHFLILFDWLRQVZKHQRSHUDWLQJLQWKLVPRGH&KDQJHVWRWKH(33VSHFLILFDWLRQVDUHH[SOLFLWO\VWDWHGLQWKLV
GRFXPHQW
,(&‹,(&
&KDQJHV WR VSHFLILFDWLRQV LQFOXGH
$GGHG 033 3RZHU 7UDQVIHU &RQWUDFW (OHPHQWV DQG UHPRYHG VXSSRUW IRU (33 53 5HFHLYHG 3RZHU
FRQWUDFWHOHPHQWV
$GGHG033GDWDSDFNHWVDQGUHPRYHGVXSSRUWIRU(33)2'GDWDSDFNHWV
2YHUULGLQJ WLPH SDUDPHWHUV
2.2 Power Receiver Requirements
033 $6. VSHFLILFDWLRQ LV EDVHG RQ 4L (33 DOOWKHWLPLQJ UHTXLUHPHQWVVSHFLILFDWLRQV VSHFLILHG E\ ([WHQGHG
3RZHU3URILOHDSSO\WR033
$OO VWDQGDUG 4LSDFNHWVXVHG LQ 033 IROORZ WKH 4LVSHFLILFDWLRQV &KDQJHVWR WKH KDQGOLQJ RU WKH GHILQLWLRQ RI
WKHSDFNHWVDUHH[SOLFLWO\VWDWHGLQWKLVGRFXPHQW
2.2.1 Amplitude Shift Keying (ASK)
033 IROORZV WKH 4L $6. VSHFLILFDWLRQV
2.2.2 Startup Behavior
$Q 033FRPSDWLEOH 3RZHU 5HFHLYHU VKDOO VWDUW E\ VHQGLQJ WKH IROORZLQJVHTXHQFHRI SDFNHWVGXULQJWKH
SLQJFRQILJXUDWLRQSKDVH
6LJQDO 6WUHQJWK 6,*
,GHQWLILFDWLRQ ,'
([WHQGHG ,GHQWLILFDWLRQ ;,'
3RZHU &RQWURO +ROG2II 3&+Optional
&RQILJXUDWLRQ 3DFNHW &)*
7KHSDFNHWV VKDOO FRQWDLQWKH033 LGHQWLILHUV DV GHVFULEHG LQ WKLV VHFWLRQ WR DOORZ DQ 033FRPSDWLEOH 3RZHU
7UDQVPLWWHUWRLGHQWLI\WKH3RZHU5HFHLYHU
PRx PTx
SIG
ID
XID
PCH (Optional)
CFG
Figure 2.1: 033,'&)*3KDVH3DFNHWV
Signal Strength (SIG)
3RZHU5HFHLYHUVKDOOUHSRUWWKH6LJQDO6WUHQJWK6,*GDWDSDFNHWIROORZLQJWKH4L VSHFLILFDWLRQV
,(&‹,(&
Identification (ID)
3RZHU5HFHLYHUVKDOOUHSRUWWKH,GHQWLILFDWLRQ3DFNHW,'ZLWKWKHIROORZLQJSDUDPHWHUVDVVKRZQLQ)LJXUH
DQG7DEOH
b7 b6 b5 b4 b3 b2 b1 b0
Major Minor
B0
B1
PRMC
B2
Ext
B3
B4 Random Iden;Įer
B5
Mfg Rsvd
B6
Figure 2.2: 033,'3DFNHW6WUXFWXUH
Table 2.1: 033,'3DFNHW3DUDPHWHUV
Field Value
0DMRU9HUVLRQ
0LQRU9HUVLRQ
0DQXIDFWXUHU&RGH350& $VVLJQHG350&FRGH
([W
5DQGRP,GHQWLILHU )ROORZV5DQGRP'HYLFH,GHQWLILHU3ROLF\
0IJ5HVHUYHG 5HVHUYHGIRU0DQXIDFWXUHU·VXVH3URSULHWDU\
5HIHUWR4L&RPPXQLFDWLRQV3URWRFROVHFWLRQIRUPRUHLQIRUPDWLRQRQ5DQGRP'HYLFH,GHQWLILHUSROLF\
Extended Identification (XID)
3RZHU5HFHLYHUVKDOOUHSRUWWKH033([WHQGHG,GHQWLILFDWLRQ3DFNHW;,'WRDGYHUWLVH033VXSSRUW'HWDLOHG
SDFNHWGHILQLWLRQLVGHVFULEHGLQVHFWLRQ
b7 b6 b5 b4 b3 b2 b1 b0
0xFE
B0
Restricted Mfg Rsvd
B1
B2 Mfg Rsvd
VRECT
B3
B4 Alpha0 Rx
Alpha1 Rx
B5
Alpha-Kth Rx
B6
B7 Mfg Rsvd
Figure 2.3: 033;,'3DFNHW3DUDPHWHUV
3RZHUUHFHLYHUPD\FKRRVHWRDGYHUWLVH033FRPSDWLELOLW\DQGRSHUDWHXQGHU033UHVWULFWHGPRGHE\
VHWWLQJWKH5HVWULFWHGELWDVGHVFULEHGLQ6HFWLRQ2WKHUZLVHWKH3RZHU5HFHLYHUPD\UHTXHVWWR
RSHUDWHXQGHU033)XOOPRGHE\VHWWLQJWKH5HVWULFWHGELWWR]HUR
,(&‹,(&
3RZHU5HFHLYHUPD\FKRRVHWRQRWDGYHUWLVH033FDSDELOLWLHVE\SHUIRUPLQJRQHRIWKHIROORZLQJ
6HWWLQJWKH;,'6XE+HDGHUILHOGWRDQ\YDOXHRWKHUWKDQ[)(
6NLSSLQJ;,'SDFNHWDQGVHWWLQJ([WELWWRLQ,'SDFNHW
Power Control Hold-Off (PCH) - Optional
3RZHUUHFHLYHUPD\FKRRVHWRRSHUDWHLQ5HVWULFWHGPRGHDQGODWHUVZLWFKWR033IXOOPRGH7KLVWUDQVLWLRQ
UHTXLUHVWKH3RZHU5HFHLYHUWRUHSRUW3&+SDFNHWGXULQJWKHFRQILJXUDWLRQSKDVH
5HIHUWR6HFWLRQIRUPRUHGHWDLOVRQYDOXHVHOHFWLRQ
Configuration (CFG)
3RZHU5HFHLYHUVKDOOUHSRUWWKH&RQILJXUDWLRQ&)*SDFNHWDFFRUGLQJWRWKH4LVSHFLILFDWLRQV
2.2.3 Profile Activation
'HSHQGLQJRQWKHVHOHFWHGRSHUDWLQJPRGHLQ;,'SDFNHW6HFWLRQ3RZHU5HFHLYHUVKDOOSURFHHGDV
IROORZV
MPP - Restricted35[VKDOOSURFHHGWR5HVWULFWHG3RZHU7UDQVIHU3KDVHDWN+])ROORZV4L
%DVHOLQH3URWRFRO
MPP - Full35[VKDOOHQDEOHWKH)6.GHFRGHUGHSHQGLQJRQWKHGHFRGLQJUHVXOW
D )6.0333DWWHUQ35[VKDOOSURFHHGWR0331HJRWLDWLRQ3KDVH6HFWLRQ
E )6.1$.3DWWHUQ35[VKDOOSURFHHGWR0331HJRWLDWLRQ3KDVHZLWK033HUURUVWDWXV6HFWLRQ
F 7LPHRXW(OVH35[VKDOOSURFHHGDFFRUGLQJWRWKH4LVSHFLILFDWLRQV(BPP/EPP)
)6.SDWWHUQUHVSRQVHWR&RQILJXUDWLRQ&)*SDFNHWVLVDOZD\VWUDQVPLWWHGXVLQJWKHGHIDXOW
VZLWFKLQJF\FOHV
5HIHUWR0336\VWHP6SHFLILFDWLRQV&RPPXQLFDWLRQV3K\VLFDO/D\HU )6.6HFWLRQIRUPRUH
LQIRUPDWLRQRQ)6.SDUDPHWHUV
)LJXUHVXPPDUL]HVWKHIORZ
,(&‹,(&
Ping Phase
(any frequency)
Send
Signal Strength
Identification packet
PRx supports
Proceed as non-MPP
No
MPP ? Qi v1.x PRx
Yes
Send MPP Compatible
XID
Optional: Send PCH
Data Packet
Send Configuration
Packet
Proceed to MPP-
MPP-Restricted Active Frequency
Yes Yes Restricted Power
mode ? is 360kHz ?
Transfer Phase
No No
Proceed to BPP
Power Transfer
Phase
MPP/NAK
Proceed as non-MPP
FSK Pattern
Timeout / ACK
Qi v1.x PRx
Detected ?
May proceed as a BPP/EPP PRx
Yes
Proceed to MPP
Negotiation Phase
Figure 2.4: 0333RZHU5HFHLYHU&RQILJXUDWLRQ3KDVH'HFLVLRQ7UHH
,(&‹,(&
2.3 Power Transmitter Requirements
033)6.VSHFLILFDWLRQLVEDVHGRQ4L(33DOOWKHWLPLQJUHTXLUHPHQWVVSHFLILFDWLRQVVSHFLILHGE\([WHQGHG
3RZHU3URILOHDSSO\WR0338SGDWHGSDUDPHWHUVDUHH[SOLFLWO\VWDWHGLQWKLVGRFXPHQW
2.3.1 Frequency Shift Keying (FSK)
0DJQHWLF3RZHU3URILOHY[GHILQHVIL[HG)6.SDUDPHWHUV
Table 2.2: 033)6.3DUDPHWHUV
Parameter Value Notes
6ZLWFKLQJ&\FOHV )6.VZLWFKLQJF\FOHVLVRQO\XVHGZKHQ37[UHVSRQGV
WR&)*SDFNHW6HFWLRQ
2WKHUZLVH37[VKDOOXVHVZLWFKLQJF\FOHV
3UHDPEOH ELWV $SSOLHVWR)6.3DFNHWVRQO\3DWWHUQVDUHH[FOXGHG
033XVHVSUHGHILQHG)6.SDUDPHWHUVDVVSHFLILHGLQ0336\VWHP6SHFLILFDWLRQV&RPPXQLFDWLRQV3K\VLFDO
/D\HU)6.6HFWLRQ
Packet Format
033)6.3DFNHWVWUXFWXUHLVVKRZQLQ)LJXUH
Preamble Header Message Payload Checksum
Figure 2.5: 033)6.3DFNHW6WUXFWXUH
FSK Pattern
033H[WHQGV4L(33)6.SDWWHUQUHVSRQVHVZLWK0333DWWHUQ7DEOH)LJXUH
Table 2.3: 033)6.3DWWHUQV
Response Pattern b0.b7 Notes
$&.
1$.
1'
$71
033 0333DWWHUQ
$33 5HVHUYHGSURSULHWDU\SDWWHUQ1RWH
1RWHRQAPP SDWWHUQ
7KHSURSULHWDU\SUHFXUVRULPSOHPHQWDWLRQWR033XVHVWKLVSDWWHUQ7RSUHYHQWLQWHURSHUDELOLW\SUREOHPVXVH
RIWKLVSDWWHUQLVUHVHUYHG
b3
b0 b1 b2 b4 b5 b6 b7
ZERO ONE ZERO
ONE ZERO ZERO ZERO ZERO
Figure 2.6: 033)6.3DWWHUQ)RUPDW
,(&‹,(&
2.3.2 Timings Override
FSK Response Window
'XHWRWKHDGGLWLRQRISUHDPEOHWRWKH)6.SDFNHWVWKHVWDUWRIWKH)6.SDFNHWQRZSRLQWVWRWKHVWDUWRI
SUHDPEOHRIWKH)6.SDFNHWDVVKRZQLQ)LJXUH
tresponse
Simple-query data packet
Response Pattern
tresponse
Data-request data packet Preamble
PTx Data Packet
Figure 2.7: 033)6.5HVSRQVH7LPLQJ
No Power Signal Window
7LPHGXUDWLRQEHWZHHQWZRFRQVHFXWLYHSLQJVW KDVEHHQXSGDWHG5HIHUWRWDEOH
QRSRZHU
Table 2.4: 03337[3DUDPHWHUV2YHUULGH
Parameter Symbol Minimum Target Maximum Unit
1R3RZHU6LJQDOZLQGRZ W 1$ 1$ PV
QRSRZHU
2.3.3 Startup Behavior
$IWHUGHWHFWLQJ35[SODFHPHQWRQWKHFKDUJLQJVXUIDFH03337[VKDOOSHUIRUPGLJLWDOSLQJDQGLGHQWLI\WKH
3RZHU5HFHLYHUXVLQJWKHLQIRUPDWLRQHPEHGGHGLQ,'DQG;,'SDFNHWVDVGHVFULEHGLQ6HFWLRQ
)URPWKH37[·VSHUVSHFWLYHD35[VXSSRUWV033LIERWKRIWKHIROORZLQJFRQGLWLRQVDUHVDWLVILHG
Qi Version4LSURWRFROYHUVLRQLQ,'S
...
IEC 63563-11 ®
Edition 1.0 2025-02
NORME
INTERNATIONALE
Spécification Qi version 2.0 –
Partie 11: Spécification du système MPP
ICS 29.240.99; 35.240.99 ISBN 978-2-8327-0550-6
Droits de reproduction réservés. Sauf indication contraire, aucune partie de cette publication ne peut être reproduite ni
utilisée sous quelque forme que ce soit et par aucun procédé, électronique ou mécanique, y compris la photocopie et
les microfilms, sans l'accord écrit de l'IEC ou du Comité national de l'IEC du pays du demandeur. Si vous avez des
questions sur le copyright de l'IEC ou si vous désirez obtenir des droits supplémentaires sur cette publication, utilisez
les coordonnées ci-après ou contactez le Comité national de l'IEC de votre pays de résidence.
IEC Secretariat Tel.: +41 22 919 02 11
3, rue de Varembé info@iec.ch
CH-1211 Geneva 20 www.iec.ch
Switzerland
A propos de l'IEC
La Commission Electrotechnique Internationale (IEC) est la première organisation mondiale qui élabore et publie des
Normes internationales pour tout ce qui a trait à l'électricité, à l'électronique et aux technologies apparentées.
A propos des publications IEC
Le contenu technique des publications IEC est constamment revu. Veuillez vous assurer que vous possédez l’édition la
plus récente, un corrigendum ou amendement peut avoir été publié.
Recherche de publications IEC - IEC Products & Services Portal - products.iec.ch
webstore.iec.ch/advsearchform Découvrez notre puissant moteur de recherche et consultez
La recherche avancée permet de trouver des publications gratuitement tous les aperçus des publications, symboles
IEC en utilisant différents critères (numéro de référence, graphiques et le glossaire. Avec un abonnement, vous aurez
texte, comité d’études, …). Elle donne aussi des toujours accès à un contenu à jour adapté à vos besoins.
informations sur les projets et les publications remplacées
ou retirées. Electropedia - www.electropedia.org
Le premier dictionnaire d'électrotechnologie en ligne au
IEC Just Published - webstore.iec.ch/justpublished monde, avec plus de 22 500 articles terminologiques en
Restez informé sur les nouvelles publications IEC. Just anglais et en français, ainsi que les termes équivalents
Published détaille les nouvelles publications parues. dans 25 langues additionnelles. Egalement appelé
Disponible en ligne et une fois par mois par email. Vocabulaire Electrotechnique International (IEV) en ligne.
Service Clients - webstore.iec.ch/csc
Si vous désirez nous donner des commentaires sur cette
publication ou si vous avez des questions contactez-
nous: sales@iec.ch.
- 2 - IEC 63563-11:2025 © IEC 2025
COMMISSION ÉLECTROTECHNIQUE INTERNATIONALE
____________
SPÉCIFICATION QI VERSION 2.0 –
Partie 11: Protocole de communication MPP
AVANT-PROPOS
1) La Commission Electrotechnique Internationale (IEC) est une organisation mondiale de normalisation composée
de l'ensemble des comités électrotechniques nationaux (Comités nationaux de l'IEC). L'IEC a pour objet de
favoriser la coopération internationale pour toutes les questions de normalisation dans les domaines de
l'électricité et de l'électronique. À cet effet, l'IEC – entre autres activités – publie des Normes internationales,
des Spécifications techniques, des Rapports techniques, des Spécifications accessibles au public (PAS) et des
Guides (ci-après dénommés "Publication(s) de l'IEC"). Leur élaboration est confiée à des comités d'études, aux
travaux desquels tout Comité national intéressé par le sujet traité peut participer. Les organisations
internationales, gouvernementales et non gouvernementales, en liaison avec l'IEC, participent également aux
travaux. L'IEC collabore étroitement avec l'Organisation Internationale de Normalisation (ISO), selon des
conditions fixées par accord entre les deux organisations.
2) Les décisions ou accords officiels de l'IEC concernant les questions techniques représentent, dans la mesure du
possible, un accord international sur les sujets étudiés, étant donné que les Comités nationaux de l'IEC intéressés
sont représentés dans chaque comité d'études.
3) Les Publications de l'IEC se présentent sous la forme de recommandations internationales et sont agréées
comme telles par les Comités nationaux de l'IEC. Tous les efforts raisonnables sont entrepris afin que l'IEC
s'assure de l'exactitude du contenu technique de ses publications; l'IEC ne peut pas être tenue responsable de
l'éventuelle mauvaise utilisation ou interprétation qui en est faite par un quelconque utilisateur final.
4) Dans le but d'encourager l'uniformité internationale, les Comités nationaux de l'IEC s'engagent, dans toute la
mesure possible, à appliquer de façon transparente les Publications de l'IEC dans leurs publications nationales
et régionales. Toutes divergences entre toutes Publications de l'IEC et toutes publications nationales ou
régionales correspondantes doivent être indiquées en termes clairs dans ces dernières.
5) L'IEC elle-même ne fournit aucune attestation de conformité. Des organismes de certification indépendants
fournissent des services d'évaluation de conformité et, dans certains secteurs, accèdent aux marques de
conformité de l'IEC. L'IEC n'est responsable d'aucun des services effectués par les organismes de certification
indépendants.
6) Tous les utilisateurs doivent s'assurer qu'ils sont en possession de la dernière édition de cette publication.
7) Aucune responsabilité ne doit être imputée à l'IEC, à ses administrateurs, employés, auxiliaires ou mandataires,
y compris ses experts particuliers et les membres de ses comités d'études et des Comités nationaux de l'IEC,
pour tout préjudice causé en cas de dommages corporels et matériels, ou de tout autre dommage de quelque
nature que ce soit, directe ou indirecte, ou pour supporter les coûts (y compris les frais de justice) et les dépenses
découlant de la publication ou de l'utilisation de cette Publication de l'IEC ou de toute autre Publication de l'IEC,
ou au crédit qui lui est accordé.
8) L'attention est attirée sur les références normatives citées dans cette publication. L'utilisation de publications
référencées est obligatoire pour une application correcte de la présente publication.
9) L'IEC attire l'attention sur le fait que la mise en application du présent document peut entraîner l'utilisation d'un
ou de plusieurs brevets. L'IEC ne prend pas position quant à la preuve, à la validité et à l'applicabilité de tout
droit de brevet revendiqué à cet égard. À la date de publication du présent document, l'IEC n'a pas reçu
notification qu'un ou plusieurs brevets pouvaient être nécessaires à sa mise en application. Toutefois, il y a lieu
d'avertir les responsables de la mise en application du présent document que des informations plus récentes
sont susceptibles de figurer dans la base de données de brevets, disponible à l'adresse https://patents.iec.ch.
L'IEC ne saurait être tenue pour responsable de ne pas avoir identifié tout ou partie de tels droits de propriété.
L'IEC 63563-11 a été établie par le Domaine Technique 15: Wireless Power Transfer, du comité
d'études de l’IEC 100: Systèmes et équipements audio, vidéo et multimédia. Il s'agit d'une
Norme internationale.
Il est basé sur la Spécification Qi version 2.0, Protocole de communication MPP et a été soumis
en tant que document Fast-Track.
La présente version bilingue (2025-07) correspond à la version anglaise monolingue publiée en
2025-02.
La version française de cette norme n'a pas été soumise au vote.
La langue employée pour l'élaboration de cette Norme internationale est l'anglais.
La structure et les règles éditoriales utilisées dans cette publication reflètent la pratique de
l'organisation qui l'a soumise.
Ce document a été rédigé selon les Directives ISO/IEC, Partie 2, il a été développé selon les
Directives ISO/IEC, Partie 1 et les Directives ISO/IEC, Supplément IEC, disponibles sous
www.iec.ch/members_experts/refdocs. Les principaux types de documents développés par
l'IEC sont décrits plus en détail sous www.iec.ch/publications/.
Le comité a décidé que le contenu de ce document ne sera pas modifié avant la date de stabilité
indiquée sur le site web de l'IEC sous webstore.iec.ch dans les données relatives au document
recherché. À cette date, le document sera
• reconduit,
• supprimé, ou
• révisé.
- 4 - IEC 63563-11:2025 © IEC 2025
Spécification Qi
Protocole de communication MPP
Version 2.0
avril 2023
CLAUSE DE NON-RESPONSABILITÉ
Les informations contenues dans le présent document sont considérées comme exactes à la
date de publication, mais elles sont fournies "en l'état" et peuvent contenir des erreurs. Le
Wireless Power Consortium ne donne aucune garantie, expresse ou implicite, concernant le
présent document et son contenu, y compris toute garantie de titre, de propriété, de qualité
marchande ou d'adéquation à une utilisation ou un objectif particulier. Ni le Wireless Power
Consortium, ni aucun membre du Wireless Power Consortium ne pourra être tenu
responsable des erreurs contenues dans le présent document ou des dommages, y compris
indirects ou consécutifs, résultant de l'utilisation ou de la con�iance accordée à la justesse
du présent document. Pour toute explication complémentaire sur le contenu du présent
document, ou en cas d'incohérence ou d'ambiguı̈té d'interprétation perçue, contacter :
info@wirelesspowerconsortium.com.
HISTORIQUE DE LA PUBLICATION
Version de la spécification Date de sortie Description
2.0 April 2023 Première version de cette spécification v2.0.
- 6 - IEC 63563-11:2025 © IEC 2025
Contenu
Contenu .6
Liste des tableaux . 10
1 Introduction. 12
1.1 Vue d'ensemble . 12
2 Magnetic Power Profile. 13
2.1 Vue d'ensemble . 13
2.1.1 Mode restreint . 13
2.1.2 Mode complet . 13
2.2 Exigences relatives aux récepteurs de puissance . 14
2.2.1 Clé à décalage d'amplitude (ASK) . 14
2.2.2 Comportement au démarrage . 14
2.2.3 Activation du profil . 16
2.3 Exigences relatives à l'émetteur de puissance . 19
2.3.1 Modulation par déplacement de fréquence (MDF) . 19
2.3.2 Annulation des temporisations . 20
2.3.3 Comportement au démarrage . 21
2.4 Prise en charge des protocoles EPP et MPP . 27
2.4.1 Support MPP/EPP sur PRx . 27
2.4.2 Support MPP/EPP sur PTx . 28
3 Negotiation Phase . 29
3.1 Vue d'ensemble . 29
3.2 Exigences . 29
3.2.1 Délais de la phase de négociation . 30
3.2.2 Cycles FSK . 30
3.2.3 Entrer dans la phase de négociation avec un statut d'erreur . 30
3.2.4 Prolongation du contrat de transfert d'électricité . 31
3.3 Phase de négociation - 128kHz . 32
3.3.1 Flux de négociation nominal . 32
3.3.2 Flux de négociation avec l'état d'erreur PTx. 35
3.3.3 Sélection de la fréquence . 37
3.4 Phase de négociation - 360kHz . 37
3.4.1 Capacités PRx étendues . 39
3.4.2 Capacités PTx étendues . 39
3.4.3 Paramètres de comptabilisation des pertes de puissance d'échange. 39
3.4.4 Négociation de pouvoir . 39
3.4.5 Récupération de l'identifiant étendu PTx . 39
3.4.6 Flux de données compatibles avec l'échange . 40
3.4.7 Profil de contrôle de la puissance . 40
3.4.8 Durée de l'occultation . 40
3.4.9 Requêtes / paquets propriétaires MPP . 40
3.5 Identification NFC (informatif) . 41
4 Phase de transfert de puissance . 42
4.1 Vue d'ensemble . 42
4.2 Paquet d'erreurs de contrôle étendu . 42
4.2.1 Manipulation . 42
4.2.2 Réponse PTx . 44
4.2.3 Exemple . 44
4.3 Paquet de comptabilisation des pertes de puissance . 46
4.3.1 Manipulation . 46
4.3.2 Réponse PTx . 47
4.4 État du contrôle . 48
4.5 Demande GET . 48
4.5.1 PRx initié . 48
4.5.2 PTx initié . 49
4.5.3 Exemples . 50
4.6 Transition du mode restreint MPP au mode complet . 51
4.6.1 Transition avec interruption de l'alimentation . 51
4.6.2 Transition sans interruption de l'alimentation . 51
5 Cloak Phase . 54
5.1 Vue d'ensemble . 54
5.2 Exigences en matière de cloisonnement des pings . 54
5.3 Entrée dans le manteau . 54
- 8 - IEC 63563-11:2025 © IEC 2025
5.3.1 PRx initié . 55
5.3.2 PTx initié . 55
5.4 Sortie de la cape . 57
5.5 Détecter le ping. 57
5.6 Diagramme d'état . 59
5.7 Temps d'occultation . 62
6 Extended Data Streams . 72
6.1 Vue d'ensemble . 72
6.2 Extension des flux de données simultanés . 72
6.2.1 Gestion des erreurs . 73
6.2.2 Horaires . 73
6.2.3 Compatibilité avec l'occultation . 74
6.3 Extension de l'intégrité des données . 74
6.4 Exemples . 74
7 Packets and Streams . 89
7.1 Paquets de données du récepteur de puissance . 89
7.1.1 Manteau - CLOAK (0x18) . 90
7.1.2 Erreur de contrôle étendue - XCE (0x19) . 91
7.1.3 Demande spécifique - SRQ (0x20) . 91
7.1.4 Demande spécifique [Sélection de fréquence] - SRQ/freqsel (0x20). 92
7.1.5 Demande spécifique [Niveau de puissance] - SRQ/egpl (0x20) . 93
7.1.6 Demande spécifique [Délai de ping d'occultation - Octet de poids faible] -
SRQ/cloakl (0x20) . 94
7.1.7 Demande spécifique [Délai de ping d'occultation - Octet de poids fort] -
SRQ/cloakh (0x20). 94
7.1.8 Demande spécifique [Profil de contrôle de la puissance] - SRQ/pcp (0x20)
........................................................................................................................ 95
7.1.10 Demande spécifique [Paramètres propriétaires] - SRQ/MppProp (0x20) . 96
7.1.11 Demande d'accès - GET (0x28). 97
7.1.12 Flux de données activés - EDS (0x29) . 98
7.1.13 Transport auxiliaire simultané de données - SADT (codes d'en-tête
multiples) . 98
7.1.14 Réponse au flux de données simultané - SDSR (0x38). 99
7.1.15 Contrôle de données auxiliaires simultanées - SADC (0x48) . 100
7.1.16 Rapport - REPORT (0x58:0) . 101
7.1.17 Rapport [Identification PRx] (0x58:0) . 102
7.1.18 Comptabilité des pertes de puissance (0x58:1) . 103
7.1.19 Paramètres de comptabilisation des pertes de puissance - PLAP (0x78) 103
7.1.20 Qi MPP Extended Identification - MPP-XID (0x81) . 104
Le paquet de données MPP-XID contient l'identification / les paramètres MPP.
...................................................................................................................... 104
7.1.21 Capacités étendues du récepteur de puissance - ECAP (0x84) . 105
7.2 Paquets de données du transmetteur de puissance . 106
7.2.1 État d'erreur - ERR (0x01). 107
7.2.2 Demande d'occultation - CLOAK (0x1E:0). 107
7.2.3 État du contrôle de la régulation - RCS (0x1E:3) . 108
7.2.4 État de charge - CHS (0x1F). 108
7.2.5 Demande d'obtention - GET (0x2E) . 109
7.2.6 Flux de données activés - EDS (0x2F) . 109
7.2.7 Tension de l'onduleur - INV (0x3F:0) . 110
7.2.8 Transport auxiliaire simultané de données - SADT (codes d'en-tête
multiples) . 110
7.2.10 Estimation K - KEST (0x3F:2) . 112
7.2.11 Contrôle des données auxiliaires simultanées - SADC (0x4F) . 112
7.2.12 Paramètres de comptabilisation des pertes de puissance - PLAP (0x5F) 113
7.2.13 Identification de l'émetteur de puissance étendue - XID (0x8F:0) . 114
7.2.14 Capacités étendues de l'émetteur de puissance étendue - ECAP (0x8F:1)
...................................................................................................................... 115
- 10 - IEC 63563-11:2025 © IEC 2025
Liste des tableaux
Tableau 1.1: Spécifications MPP Écart par rapport à Qi EPP . 12
Tableau 2.1 : Paramètres du paquet MPP ID . 15
Tableau 2.3 : MPP FSK Patterns . 19
Tableau 2.4 : Dépassement des paramètres MPP PTx. 21
Tableau 3.1 : Paquets PRx autorisés pendant la phase de négociation MPP . 29
Tableau 3.2 : Paramètres de synchronisation de la phase de négociation MPP . 30
Tableau 3.3 : Éléments du contrat de transfert d'électricité MPP . 32
Tableau 4.1 : Paramètres d'erreur du contrôle MPP . 43
Tableau 4.2 : Paramètres de temporisation pour la comptabilisation des pertes de
puissance . 47
Tableau 4.3 : Paramètres de synchronisation GET initiés par PTx . 49
Tableau 4.4 : Paramètres de synchronisation de la MPP restreinte à la transition
complète . 52
Tableau 5.1 : Paramètres de détection de l'occultation . 58
Tableau 5.2 : Paramètres de temps d'occultation . 62
Tableau 6.1 : Identifiants des flux de données . 72
Tableau 6.2 : Flux de données étendus Timing . 74
Tableau 6.3: Propriétés CRC du flux de données . 74
Tableau 7.1 : MPP PRx Paquets ASK . 89
Tableau 7.2 : PRx Codes de raison de la fin de l'alimentation . 90
Tableau 7.3 : Demande de fin d'alimentation Réponses FSK . 91
Tableau 7.4 : Erreur de contrôle étendue Réponses FSK . 91
Tableau 7.5 : Demandes spécifiques du PPM. 92
Tableau 7.6 : Paramètres de sélection de la fréquence de la demande spécifique . 93
Tableau 7.7 : Demande de sélection de fréquence Réponses FSK . 93
Tableau 7.8 : Demande de sélection du niveau de puissance Réponses FSK . 93
Tableau 7.9 : Cloak Ping Delay Selection Request SRQ/cloakl - FSK Responses . 94
Tableau 7.10 : Cloak Ping Delay Selection Request SRQ/cloakh - FSK Responses . 95
Tableau 7.11 : Valeurs du profil de contrôle de la puissance . 95
Tableau 7.12 : Demande de sélection du profil de contrôle de puissance Réponses FSK
.................................................................................................................................. 95
Tableau 7.13 : Détection de l'occultation Ping Délai Demande de sélection Réponse FSK
.................................................................................................................................. 96
Tableau 7.14 : Demande de paramètres spécifiques à la propriété Réponses FSK . 97
Tableau 7.15 : PRx Types de demandes d'accès . 97
Tableau 7.16 : Transport auxiliaire simultané de données - SADT Réponses FSK . 99
Tableau 7.17 : Réponse au flux de données simultanées PRx . 99
Tableau 7.18 : Champ de demande de contrôle des données auxiliaires simultanées 100
Tableau 7.19 : Champ des paramètres de contrôle des données auxiliaires simultanées
................................................................................................................................ 100
Tableau 7.20 : Champ d'identification du rapport. 101
Tableau 7.21 : Rapport [Identification PRx] Réponses FSK . 102
Tableau 7.22 : Réponses PLA FSK . 103
Tableau 7.23 : Paramètres de puissance reçue Réponses FSK. 104
Tableau 7.24 : Paquet de capacités PRx Réponses FSK . 106
Tableau 7.25 : MPP PTX Paquets FSK . 106
Tableau 7.26 : Codes d'état d'erreur PTx . 107
Tableau 7.27 : PTx End Of Power Reason Codes . 108
Tableau 7.28 : Valeurs d'état du contrôle de régulation PTx . 108
Tableau 7.29 : Valeurs de l'état de charge PTx . 109
Tableau 7.30 : Champs de la requête PTx Get . 109
Tableau 7.31 : PTx Flux de données simultanées Type de réponse . 111
Tableau 7.32 : PTx Code de raison de la limite de puissance . 115
- 12 - IEC 63563-11:2025 © IEC 2025
1 Introduction .
1.1 Vue d'ensemble
Le profil de puissance magnétique (MPP) est une extension de protocole qui fournit des messages
supplémentaires, de nouveaux états/modes de puissance, de nouveaux éléments de contrat de transfert
de puissance, et vise à fournir les fonctionnalités suivantes :
• Négociation de la fréquence de fonctionnement
• Occultation (pause de puissance)
• Échange d'informations génériques
• Transactions simultanées de flux de données
• Communication rapide de PTx à PRx
• Détermination de la puissance maximale et des profils de contrôle de la puissance
• Négociation de pouvoir élargie
• Identification et capacités PTx/PRx étendues
• Paquets d'erreurs de contrôle étendus et paquets de puissance reçus
• Rapport sur le niveau de la batterie de l'émetteur de puissance
• Évolutivité de l'écosystème
Le tableau 1.1 ci-dessous résume les différences entre le profil de puissance magnétique et l'EPP.
L'extension MPP permet aux appareils de fonctionner en mode restreint (pas de communication PTx) à 360
kHz sans effectuer de négociation explicite avec l'émetteur de puissance. Cette flexibilité permet aux
appareils disposant de ressources limitées (par exemple, les appareils ne prenant pas en charge la MDF) de
tirer parti du phénomène de changement de fréquence.
Tableau 1.1: Spécifications MPP Écart par rapport à Qi EPP
Le phénomène PPE PPM
PTx Handshake Message EPP FSK ACK Message MPP FSK ACK Message
(Section 2.3.1)
Négociation des EPP permet la négociation Paramètres FSK fixes
paramètres FSK des paramètres FSK
Flux de données Transfert à flux unique Transferts multiples simultanés
Détection des objets Paquet FOD, étalonnage, Remplacé par MPP Power Loss
étrangers RP Dossier comptable
Magnetic Power Profile
2.1 Vue d'ensemble
Cet article (selon le contexte) décrit les exigences du récepteur et de l'émetteur d'énergie pour le profil
d'énergie magnétique et les modes que les appareils peuvent utiliser pour communiquer.
MPP prend en charge deux modes de protocole :
1. Mode restreint: Communication unidirectionnelle (PRx à PTx) avec des niveaux de puissance limités
(5W PRECT) utilisant le protocole Qi Baseline Protocol.
2. Full Mode: Prise en charge de la communication bidirectionnelle et possibilité de négocier des niveaux
de puissance plus élevés
2.1.1 Mode restreint
Le mode MPP restreint permet au PRx d'établir une session de charge avec le PTx en utilisant une
communication unidirectionnelle.
(PRx à PTx) à une fréquence de fonctionnement de 360kHz en utilisant le protocole Qi Baseline.
PTx et PRx doivent respecter les spécifications du protocole de base Qi lorsqu'ils fonctionnent en mode
restreint.
(Informatif)
Le mode MPP restreint peut être utilisé lorsque le PRx fonctionne dans un environnement contraint, par
exemple lorsque l'appareil est entièrement déchargé
PRx est autorisé à passer du mode MPP restreint au mode MPP complet pour permettre une communication
bidirectionnelle et des niveaux de puissance plus élevés. Reportez-vous à la section 4.6 pour plus de détails
sur la manière d'effectuer la transition.
2.1.2 Mode complet
Le mode MPP Full permet une session de charge avec une communication bidirectionnelle entre PTx et PRx
permettant aux appareils d'effectuer des opérations plus complexes telles que l'échange d'informations
d'identification, les capacités des appareils, les coefficients d'évolutivité de l'écosystème, la négociation
de la puissance et l'authentification.
En mode MPP Full, les appareils peuvent passer d'une phase de protocole à l'autre (négociation,
transfert de puissance, occultation) et sont en mesure de négocier des niveaux de puissance plus
élevés qu'en mode Restricted.
Le mode MPP Full est basé sur le protocole Qi Extended Power Profile (EPP). PTx et PRx doivent respecter
les spécifications Qi EPP lorsqu'ils fonctionnent dans ce mode. Les modifications apportées aux
spécifications de l'EPP sont explicitement mentionnées dans le présent document.
Les modifications apportées aux spécifications sont les suivantes :
1. Ajout d'éléments contractuels de transfert de puissance MPP et suppression de la prise en charge des
éléments contractuels EPP RP (Received Power).
2. Ajout des paquets de données MPP et suppression de la prise en charge des paquets de données EPP
FOD
3. Remplacement des paramètres temporels
- 14 - IEC 63563-11:2025 © IEC 2025
2.2 Exigences relatives aux récepteurs de puissance
La spécification MPP ASK est basée sur Qi EPP, toutes les exigences/spécifications de synchronisation
spécifiées par Extended Power Profile s'appliquent à MPP.
Tous les paquets Norme Qi utilisés dans MPP sont conformes aux spécifications Qi. Les modifications
apportées au traitement ou à la définition des paquets sont explicitement mentionnées dans le présent
document.
2.2.1 Clé à décalage d'amplitude (ASK)
MPP suit les spécifications Qi ASK.
2.2.2 Comportement au démarrage
Un récepteur de puissance compatible MPP doit commencer par envoyer la séquence de paquets suivante au
cours du
phase de ping/configuration.
1. Intensité du signal (SIG)
2. Identification (ID)
3. Identification étendue (XID)
4. Maintien de la commande d'alimentation (PCH) - En option
5. Paquet de configuration (CFG)
Les paquets doivent contenir les identificateurs MPP décrits dans la présente section afin de permettre à
un système compatible MPP
Anglais Français
(Optional) (optionnel)
Figure 2.1: Paquets MPP ID/CFG Phase 1
Intensité du signal (SIG)
Le récepteur de puissance doit transmettre le paquet de données sur l'intensité du signal (SIG)
conformément aux spécifications Qi.
Identification (ID)
Le récepteur de puissance doit transmettre le paquet d'identification (ID) avec les paramètres suivants,
comme indiqué à la Figure 2.2 et au Tableau 2.1.
b7 b6 b5 b4 b3 b2 b1
Principale Mineur
B0
B1
PRMC
B2
Ext.
B3
B4 Au hasard Iden fier
;
B5
Mfg Rsvd
B6
Figure 2.2: Structure du paquet MPP ID
Tableau 2.1 : Paramètres du paquet MPP ID
Champ d'application Valeur
Version majeure 2
Version mineure 0
Code du fabricant (PRMC) Code PRMC attribué
Ext. 1
Identifiant aléatoire Respect de la politique d'identification des dispositifs aléatoires
(Random Device Identifier)
Mfg Réservé Réservé à l'utilisation du fabricant (propriétaire)
Reportez-vous à la section 8.11 du protocole de communication Qi pour plus d'informations sur la politique
d'identification aléatoire des appareils.
Identification étendue (XID)
Le récepteur de puissance doit signaler le paquet d'identification étendu MPP (XID) pour annoncer la prise en
charge MPP. La définition détaillée des paquets est décrite au point 7.1.20.
b7 b6 b4 b3 b2 b1 b0
0xFE
B0
Restreint Mfg Rsvd
B1
Mfg Rsvd
B2
VRECT
B3
Alpha0 Rx
B4
Alpha1 Rx
B5
Alpha-Kth Rx
B6
Mfg Rsvd
B7
Figure 2.3: Paramètres du paquet MPP XID
Le récepteur de puissance peut choisir d'annoncer la compatibilité MPP et de fonctionner en mode restreint
MPP en définissant le bit Restricted comme décrit dans la section 7.1.20. Sinon, le récepteur de puissance peut
demander à fonctionner en mode MPP Full en mettant le bit Restricted à zéro.
Le récepteur de puissance peut choisir de ne pas annoncer les capacités MPP en effectuant l'une des opérations
suivantes :
1. Attribution au champ (XID Sub Header) d'une valeur autre que 0xFE
2. Sauter le paquet XID et mettre le bit Ext à 0 dans le paquet ID
- 16 - IEC 63563-11:2025 © IEC 2025
Maintien du contrôle de la puissance (PCH) - En option
Le récepteur de puissance peut choisir de fonctionner en mode restreint et de passer ultérieurement en mode
MPP complet. Cette transition
exige que l'Exigence de puissance signale le paquet PCH pendant la phase de configuration.
Voir la section 4.6 pour plus de détails sur la sélection des valeurs.
Configuration (CFG)
Le récepteur de puissance doit transmettre le paquet de configuration (CFG) décrit(e) en fonction des
spécifications Qi.
2.2.3 Activation du profil
En fonction du mode de fonctionnement sélectionné dans le paquet XID (section 2.2.2), le récepteur de
puissance doit procéder comme suit
suit :
1. MPP - Restreint:. PRx doit passer à la phase de transfert de puissance restreinte à 360 kHz
(conformément au protocole de base Qi).
2. MPP - Plein: PRx doit activer le décodeur FSK, en fonction du résultat du décodage :
a) FSK MPP Pattern : Le PRx doit passer à la phase de négociation du PPM (section 3)
b) FSK NAK Pattern : Le PRx doit passer à la phase de négociation MPP avec l'état d'erreur MPP
(section 3).
c) Timeout / Else : PRx doit se dérouler conformément aux spécifications Qi (BPP/EPP).
1. La réponse du motif FSK aux paquets de configuration (CFG) est toujours transmise en utilisant les 512
cycles de commutation par défaut.
2. Se référer aux spécifications du système MPP - couche physique des communications : FSK (section
6.2) pour plus d'informations sur les paramètres FSK.
La Figure 2.4 résume le flux.
- 18 - IEC 63563-11:2025 © IEC 2025
Anglais Français
Ping Phase Phase Ping
(any frequency) (toutes les fréquences)
Send Envoyer
Signal Strength Identification packet Paquet d'identification de l'intensité du signal
PRx supports MPP? PRx soutient MPP ?
No Non
Proceed as non-MPP Procéder comme s'il ne s'agissait pas d'une PPM
Qi v1.x PRx Qi v1.x PRx
Yes Oui
Send MPP Compatible XID Envoyer un XID compatible MPP
Optional: Send PCH Data Packet En option : Envoi du paquet de données PCH
Send Configuration Packet Envoi du paquet de configuration
MPP-Restricted mode ? Mode restreint MPP ?
Active Frequency is 360kHz? La fréquence active est de 360 kHz ?
Proceed to MPP-Restricted Power Transfer Phase Passer à la phase de transfert de puissance restreinte
MPP
Proceed to BPP Power Transfer Phase Passer à la phase de transfert d'énergie du BPP
MPP/NAK FSK Pattern Detected ? MPP/NAK FSK Pattern Detected ?
Timeout / ACK Délai d'attente / ACK
May proceed as a BPP/EPP PRx Peut se dérouler comme un PRx BPP/EPP
Proceed to MPP Negotiation Phase Passer à la phase de négociation des PPM
Figure 2.4: Arbre de décision de la phase de configuration du récepteur de puissance MPP
2.3 Exigences relatives à l'émetteur de puissance
La spécification MPP FSK est basée sur Qi EPP, toutes les exigences/spécifications de synchronisation
spécifiées par Extended Power Profile s'appliquent à MPP. Les paramètres mis à jour sont explicitement
indiqués dans le présent document.
2.3.1 Modulation par déplacement de fréquence (MDF)
Le profil de puissance magnétique v1.x définit des paramètres FSK fixes :
Tableau 2.2 : MPP Paramètres FSK
Paramètres Valeur Note
Cycles de commutation 512 / 128 Les cycles de commutation FSK 512 ne sont utilisés que
lorsque PTx répond
au paquet CFG (section 2.2.3)
Dans le cas contraire, PTx doit utiliser 128 cycles de
commutation
Préambule 4 bits (1111) S'applique uniquement aux paquets FSK (les motifs sont
exclus).
MPP utilise des paramètres FSK prédéfinis, comme indiqué dans les spécifications du système MPP -
couche physique des communications : FSK (section 6.2)
Format du paquet
La structure du paquet MPP FSK est illustrée à la Figure 2.5.
Anglais Français
Preamble Préambule
Header En-tête
Message Payload Charge utile du message
Checksum Somme de contrôle
Figure 2.5: Structure du paquet MPP FSK
Modèle FSK
MPP étend les réponses du modèle FSK de Qi EPP avec le modèle MPP (tableau 2.3, figure 2.6).
Tableau 2.3 : MPP FSK Patterns
Réponse Modèle b0.b7 Note
ACK 1111 1111
NAK 0000 0000
ND 1010 1010
ATN 1100 1100
PPM 1000 1000 Modèle MPP
APP 1111 0000 Modèle propriétaire réservé (Note)
- 20 - IEC 63563-11:2025 © IEC 2025
Note sur APP mode:.
L'implémentation propriétaire du précurseur de MPP utilise ce modèle. Pour éviter les problèmes
d'interopérabilité, l'utilisation de ce modèle est réservée.
Anglais Français
ONE UN
ZERO ZERO
Figure 2.6: Format du motif MPP FSK
2.3.2 Annulation des temporisations
Fenêtre de réponse FSK
En raison de l'ajout d'un préambule aux paquets FSK, le début du paquet FSK pointe désormais sur le début du
préambule du paquet FSK, comme le montre la Figure 2.7.
Anglais Français
Simple-query data packet Paquet de données de simple requête
Response Pattern Modèle de réponse
Data-request data packet Paquet de données de demande de données
Preamble Préambule
PTx Data Packet Paquet de données PTx
Figure 2.7: Temps de réponse MPP F SK
Fenêtre de signalisation non alimentée
La durée entre deux pings consécutifs a été mise à jour. Voir le tableau 2.4.
(tnopower)
Tableau 2.4 : Dépassement des paramètres MPP PTx
Paramètres Symbole Minimale Cible Maximale Unité
Pas de fenêtre de signal de t 50 N/A N/A ms
nopower
puissance
2.3.3 Comportement au démarrage
Après avoir détecté le placement de la PRx sur la surface de charge, le MPP PTx doit effectuer un ping
numérique et identifier la
Power Receiver en utilisant les informations contenues dans les paquets ID et XID comme décrit dans la
section 2.2.2.
Du point de vue de la PTx, une PRx soutient la MPP si les deux conditions suivantes sont remplies :
1. Qi Version: La version du protocole Qi dans le paquet ID (section 2.2.2) est réglée sur (Major=2,
Minor=0) ou plus.
2. Support MPP annoncé: Le sous-en-tête (octet 0) du paquet XID est réglé sur le sélecteur MPP
(section 7.1.20).
Si les conditions ne sont pas remplies, l'émetteur de puissance doit passer à la phase suivante
conformément aux spécifications Qi.
En fonction du niveau de ping numérique utilisé pour établir la communication à la fréquence de 128 kHz,
PTx doit définir un état d'erreur interne comme suit :
• Erreur = Aucune:. La communication à 128 kHz a été établie en utilisant le niveau de ping numérique
"Qi_HB_Low".
• Erreur = inadéquation du niveau de ping numérique:. Dans le cas contraire
PTx doit alors passer au mode de fonctionnement MPP demandé, indiqué dans le paquet MPP-XID, comme
suit :
• Activer le mode restreint : Si l'indicateur "Restricted" a la valeur 1.
• Activer le mode complet : Si l'indicateur "Restricted" est mis à zéro.
La PTx doit effacer l'état d'erreur si elle décide de supprimer le signal d'alimentation pour une raison
quelconque, c'est-à-dire que l'état d'erreur ne doit pas persister lors des redémarrages de la communication.
Mode restreint MPP
PRx peut choisir de fonctionner en mode de puissance restreinte MPP en définissant le champ Restricted
dans MPP-XID
paquet à 1.
PTx doit décoder le paquet MPP-XID et procéder comme suit :
• Si la fréquence active est de 360 kHz : Poursuivre en supposant que le mode MPP est restreint
• Autre : Procéder en fonction de l'état de l'erreur
Si l'état d'erreur n'est pas défini, PTx doit retirer le signal de puissance et commencer l
...
IEC 63563-11 ®
Edition 1.0 2025-02
INTERNATIONAL
STANDARD
NORME
INTERNATIONALE
Qi Specification version 2.0 –
Part 11: MPP System Specification
Spécification Qi version 2.0 –
Partie 11: Spécification du système MPP
ICS 29.240.99, 35.240.99 ISBN 978-2-8327-0550-6
All rights reserved. Unless otherwise specified, no part of this publication may be reproduced or utilized in any form or
by any means, electronic or mechanical, including photocopying and microfilm, without permission in writing from either
IEC or IEC's member National Committee in the country of the requester. If you have any questions about IEC copyright
or have an enquiry about obtaining additional rights to this publication, please contact the address below or your local
IEC member National Committee for further information.
Droits de reproduction réservés. Sauf indication contraire, aucune partie de cette publication ne peut être reproduite ni
utilisée sous quelque forme que ce soit et par aucun procédé, électronique ou mécanique, y compris la photocopie et
les microfilms, sans l'accord écrit de l'IEC ou du Comité national de l'IEC du pays du demandeur. Si vous avez des
questions sur le copyright de l'IEC ou si vous désirez obtenir des droits supplémentaires sur cette publication, utilisez
les coordonnées ci-après ou contactez le Comité national de l'IEC de votre pays de résidence.
IEC Secretariat Tel.: +41 22 919 02 11
3, rue de Varembé info@iec.ch
CH-1211 Geneva 20 www.iec.ch
Switzerland
About the IEC
The International Electrotechnical Commission (IEC) is the leading global organization that prepares and publishes
International Standards for all electrical, electronic and related technologies.
About IEC publications
The technical content of IEC publications is kept under constant review by the IEC. Please make sure that you have the
latest edition, a corrigendum or an amendment might have been published.
IEC publications search - IEC Products & Services Portal - products.iec.ch
webstore.iec.ch/advsearchform Discover our powerful search engine and read freely all the
The advanced search enables to find IEC publications by a publications previews, graphical symbols and the glossary.
variety of criteria (reference number, text, technical With a subscription you will always have access to up to date
committee, …). It also gives information on projects, content tailored to your needs.
replaced and withdrawn publications.
Electropedia - www.electropedia.org
IEC Just Published - webstore.iec.ch/justpublished The world's leading online dictionary on electrotechnology,
Stay up to date on all new IEC publications. Just Published containing more than 22 500 terminological entries in English
details all new publications released. Available online and and French, with equivalent terms in 25 additional languages.
Also known as the International Electrotechnical Vocabulary
once a month by email.
(IEV) online.
IEC Customer Service Centre - webstore.iec.ch/csc
If you wish to give us your feedback on this publication or
need further assistance, please contact the Customer
Service Centre: sales@iec.ch.
A propos de l'IEC
La Commission Electrotechnique Internationale (IEC) est la première organisation mondiale qui élabore et publie des
Normes internationales pour tout ce qui a trait à l'électricité, à l'électronique et aux technologies apparentées.
A propos des publications IEC
Le contenu technique des publications IEC est constamment revu. Veuillez vous assurer que vous possédez l’édition la
plus récente, un corrigendum ou amendement peut avoir été publié.
Recherche de publications IEC - IEC Products & Services Portal - products.iec.ch
webstore.iec.ch/advsearchform Découvrez notre puissant moteur de recherche et consultez
La recherche avancée permet de trouver des publications gratuitement tous les aperçus des publications, symboles
IEC en utilisant différents critères (numéro de référence, graphiques et le glossaire. Avec un abonnement, vous aurez
texte, comité d’études, …). Elle donne aussi des toujours accès à un contenu à jour adapté à vos besoins.
informations sur les projets et les publications remplacées
ou retirées. Electropedia - www.electropedia.org
Le premier dictionnaire d'électrotechnologie en ligne au
IEC Just Published - webstore.iec.ch/justpublished monde, avec plus de 22 500 articles terminologiques en
Restez informé sur les nouvelles publications IEC. Just anglais et en français, ainsi que les termes équivalents
Published détaille les nouvelles publications parues. dans 25 langues additionnelles. Egalement appelé
Disponible en ligne et une fois par mois par email. Vocabulaire Electrotechnique International (IEV) en ligne.
Service Clients - webstore.iec.ch/csc
Si vous désirez nous donner des commentaires sur cette
publication ou si vous avez des questions contactez-
nous: sales@iec.ch.
- 2 - IEC 63563-11:2025 © IEC 2025
INTERNATIONAL ELECTROTECHNICAL COMMISSION
____________
QI SPECIFICATION VERSION 2.0 –
Part 11: MPP System Specification
FOREWORD
1) The International Electrotechnical Commission (IEC) is a worldwide organization for standardization comprising all
national electrotechnical committees (IEC National Committees). The object of IEC is to promote international co-
operation on all questions concerning standardization in the electrical and electronic fields. To this end and in addition
to other activities, IEC publishes International Standards, Technical Specifications, Technical Reports, Publicly
Available Specifications (PAS) and Guides (hereafter referred to as “IEC Publication(s)”). Their preparation is entrusted to
technical committees; any IEC National Committee interested in the subject dealt with may participate in this
preparatory work. International, governmental and non-governmental organizations liaising with the IEC also
participate in this preparation. IEC collaborates closely with the International Organization for Standardization
(ISO) in accordance with conditions determined by agreement between the two organizations.
2) The formal decisions or agreements of IEC on technical matters express, as nearly as possible, an international
consensus of opinion on the relevant subjects since each technical committee has representation from all
interested IEC National Committees.
3) IEC Publications have the form of recommendations for international use and are accepted by IEC National
Committees in that sense. While all reasonable efforts are made to ensure that the technical content of IEC
Publications is accurate, IEC cannot be held responsible for the way in which they are used or for any
misinterpretation by any end user.
4) In order to promote international uniformity, IEC National Committees undertake to apply IEC Publications
transparently to the maximum extent possible in their national and regional publications. Any divergence between any IEC
Publication and the corresponding national or regional publication shall be clearly indicated in the latter.
5) IEC itself does not provide any attestation of conformity. Independent certification bodies provide conformity
assessment services and, in some areas, access to IEC marks of conformity. IEC is not responsible for any
services carried out by independent certification bodies.
6) All users should ensure that they have the latest edition of this publication.
7) No liability shall attach to IEC or its directors, employees, servants or agents including individual experts and
members of its technical committees and IEC National Committees for any personal injury, property damage or other
damage of any nature whatsoever, whether direct or indirect, or for costs (including legal fees) and expenses
arising out of the publication, use of, or reliance upon, this IEC Publication or any other IEC Publications.
8) Attention is drawn to the Normative references cited in this publication. Use of the referenced publications is
indispensable for the correct application of this publication.
9) IEC draws attention to the possibility that the implementation of this document may involve the use of (a)
patent(s). IEC takes no position concerning the evidence, validity or applicability of any claimed patent rights in respect
thereof. As of the date of publication of this document, IEC had not received notice of (a) patent(s), which may be
required to implement this document. However, implementers are cautioned that this may not represent the latest
information, which may be obtained from the patent database available at https://patents.iec.ch. IEC shall
not be held responsible for identifying any or all such patent rights.
IEC 63563-11 has been prepared by technical area 15: Wireless Power Transfer, of IEC
technical committee 100: Audio, video and multimedia systems and equipment. It is an
International Standard.
It is based on Qi Specification version 2.0, MPP Communications Protocol and was submitted
as a Fast-Track document.
The text of this International Standard is based on the following documents:
Draft Report on voting
100/4255/FDIS 100/4276/RVD
Full information on the voting for its approval can be found in the report on voting indicated in
the above table.
The language used for the development of this International Standard is English.
The structure and editorial rules used in this publication reflect the practice of the organization
which submitted it.
This document was developed in accordance with ISO/IEC Directives, Part 1 and ISO/IEC
Directives, IEC Supplement available at www.iec.ch/members_experts/refdocs. The main
document types developed by IEC are described in greater detail at www.iec.ch/publications.
The committee has decided that the contents of this document will remain unchanged until the
stability date indicated on the IEC website under webstore.iec.ch in the data related to the
specific document. At this date, the document will be
• reconfirmed,
• withdrawn, or
• revised.
- 4 - IEC 63563-11:2025 © IEC 2025
WIRELESS POWER
CONSORTIUM
Qi Specification
MPP Communications Protocol
Version 2.0
April 2023
DISCLAIMER
The information contained herein is believed to be accurate as of the date of publication,
but is provided “as is” and may contain errors. The Wireless Power Consortium makes no
warranty, express or implied, with respect to this document and its contents, including any
warranty of title, ownership, merchantability, or fitness for a particular use or purpose.
Neither the Wireless Power Consortium, nor any member of the Wireless Power
Consortium will be liable for errors in this document or for any damages, including indirect
or consequential, from use of or reliance on the accuracy of this document. For any further
explanation of the contents of this document, or in case of any perceived inconsistency or ambiguity
of interpretation, contact: info@wirelesspowerconsortium.com.
RELEASE HISTORY
Specification Version Release Date Description
2.0 April 2023 First release of this v2.0 specification.
- 6 - IEC 63563-11:2025 © IEC 2025
Contents
Contents 2
List of Tables 5
1 Introduction
1.1 Overview . 8
2 Magnetic Power Profile 10
2.1 Overview . 10
2.1.1 Restricted Mode . 10
2.1.2 Full Mode . 10
2.2 Power Receiver Requirements . 11
2.2.1 Amplitude Shift Keying (ASK) . 11
2.2.2 Startup Behavior . 11
2.2.3 Profile Activation . 13
2.3 Power Transmitter Requirements . 15
2.3.1 Frequency Shift Keying (FSK) . 15
2.3.2 Timings Override . 16
2.3.3 Startup Behavior . 16
2.4 Supporting EPP and MPP protocols . 19
2.4.1 MPP/EPP Support on PRx . 19
2.4.2 MPP/EPP Support on PTx . 20
3 Negotiation Phase 21
3.1 Overview . 21
3.2 Requirements . 21
3.2.1 Negotiation Phase Timings . 22
3.2.2 FSK Cycles . 22
3.2.3 Entering Negotiation Phase With Error Status . 22
3.2.4 Power Transfer Contract Extension . 23
3.3 Negotiation Phase - 128kHz . 24
3.3.1 Nominal negotiation flow . 24
3.3.2 Negotiation flow with PTx error status . 26
3.3.3 Frequency Selection . 27
3.4 Negotiation Phase - 360kHz . 27
3.4.1 PRx Extended Capabilities . 30
3.4.2 PTx Extended Capabilities . 30
3.4.3 Exchange Power Loss Accounting Parameters . 30
3.4.4 Power Negotiation . 30
3.4.5 Retrieve PTx Extended ID . 30
3.4.6 Exchange Enabled Data Streams . 30
3.4.7 Power Control Profile . 30
3.4.8 Cloaking Duration . 30
3.4.9 MPP Proprietary Requests / Packets . 31
3.5 NFC Identification (Informative) . 32
4 Power Transfer Phase 33
4.1 Overview . 33
4.2 Extended Control Error Packet . 33
4.2.1 Handling . 33
4.2.2 PTx Response . 34
4.2.3 Example . 34
4.3 Power Loss Accounting Packet . 36
4.3.1 Handling . 36
4.3.2 PTx Response . 37
4.4 Control Status . 37
4.5 GET Request . 37
4.5.1 PRx Initiated . 37
4.5.2 PTx Initiated . 38
4.5.3 Examples . 38
4.6 MPP-Restricted to Full mode Transition . 39
4.6.1 Transition with power interruption . 40
4.6.2 Transition without power interruption . 40
5 Cloak Phase 43
5.1 Overview . 43
5.2 Cloak Ping Requirements . 43
5.3 Cloak Entry . 43
5.3.1 PRx Initiated . 44
5.3.2 PTx Initiated . 44
5.4 Cloak Exit . 45
5.5 Detect ping . 46
5.6 State Diagram . 46
5.7 Cloak Timings . 49
5.8 Examples. 50
6 Extended Data Streams 56
6.1 Overview . 56
6.2 Simultaneous Data Stream Extension . 56
6.2.1 Error Handling . 57
6.2.2 Timings . 57
6.2.3 Cloaking Compatibility . 57
6.3 Data Integrity Extension . 58
6.4 Examples. 58
7 Packets and Streams 67
7.1 Power Receiver data packets . 67
7.1.1 Cloak - CLOAK (0x18) . 69
7.1.2 Extended Control Error - XCE (0x19) . 70
Specific Request - SRQ (0x20) . 71
7.1.3
- 8 - IEC 63563-11:2025 © IEC 2025
7.1.4 Specific Request [Frequency Selection] - SRQ/freqsel (0x20) . 75
7.1.5 Specific Request [Power Level] - SRQ/egpl (0x20) . 76
7.1.6 Specific Request [Cloak Ping Delay - Low Byte] - SRQ/cloakl (0x20) . 77
7.1.7 Specific Request [Cloak Ping Delay - High Byte] - SRQ/cloakh (0x20) . 78
7.1.8 Specific Request [Power Control Profile] - SRQ/pcp (0x20) . 79
7.1.9 Specific Request [Cloak Detect Ping Delay] - SRQ/detect (0x20) . 80
7.1.10 Specific Request [Proprietary Parameters] - SRQ/MppProp (0x20) . 81
7.1.11 Get Request - GET (0x28) . 82
7.1.12 Enabled Data Streams - EDS (0x29) . 83
7.1.13 Simultaneous Auxiliary Data Transport - SADT (multiple header codes) . 84
7.1.14 Simultaneous Data Stream Response - SDSR (0x38) . 85
7.1.15 Simultaneous Auxiliary Data Control - SADC (0x48) . 86
7.1.16 Report - REPORT (0x58:0). 87
7.1.17 Report [PRx Identification] (0x58:0) . 88
7.1.18 Power Loss Accounting (0x58:1) . 89
7.1.19 Power Loss Accounting Parameters - PLAP (0x78) . 90
7.1.20 Qi MPP Extended Identification - MPP-XID (0x81) . 91
7.1.21 Extended Power Receiver Capabilities - ECAP (0x84). 92
7.2 Power Transmitter data packets . 93
7.2.1 Error Status - ERR (0x01) . 94
7.2.2 Cloak Request - CLOAK (0x1E:0) . 95
7.2.3 Regulation Control Status - RCS (0x1E:3) . 96
7.2.4 Charge Status - CHS (0x1F) . 97
7.2.5 Get Request - GET (0x2E) . 98
7.2.6 Enabled Data Streams - EDS (0x2F) . 99
7.2.7 Inverter Voltage - INV (0x3F:0) . 100
7.2.8 Simultaneous Auxiliary Data Transport - SADT (multiple header codes) . 101
7.2.9 Simultaneous Data Stream Response - SDSR (0x3F:1) . 102
7.2.10 Estimated K - KEST (0x3F:2) . 103
7.2.11 Simultaneous Auxiliary Data Control - SADC (0x4F) . 104
7.2.12 Power Loss Accounting Parameters - PLAP (0x5F) . 105
7.2.13 Extended Power Transmitter Identification - XID (0x8F:0) . 106
7.2.14 Extended Power Transmitter Extended Capabilities - ECAP (0x8F:1) . 107
List of Tables
1.1 MPP Specifications Departure from Qi EPP . 8
2.1 MPP ID Packet Parameters. 11
2.2 MPP FSK Parameters . 14
2.3 MPP FSK Patterns. 14
2.4 MPP PTx Parameters Override . 15
3.1 PRx packets allowed during MPP negotiation phase . 20
3.2 MPP Negotiation Phase Timing Parameters. 21
3.3 MPP Power Transfer Contract Elements . 23
4.1 MPP Control Error Parameters . 33
4.2 Power Loss Accounting Timing Parameters . 35
4.3 PTx Initiated GET Timing Parameters . 37
4.4 MPP Restricted to Full Transition Timing Parameters . 39
5.1 Cloak Detect Parameters . 45
5.2 Cloak Time Parameters . 48
6.1 Data Streams Identifiers . 55
6.2 Extended Data Streams Timing . 56
6.3 Data Stream CRC Properties . 57
7.1 MPP PRx ASK Packets . 68
7.2 PRx End Of Power Reason Codes . 69
7.3 End Of Power Request FSK Responses . 69
7.4 Extended Control Error FSK Responses. 70
7.5 MPP Specific Requests . 71
7.6 Specific Request Frequency Selection parameters . 72
7.7 Frequency Selection Request FSK Responses . 72
7.8 Power Level Selection Request FSK Responses . 73
7.9 Cloak Ping Delay Selection Request SRQ/cloakl - FSK Responses . 74
7.10 Cloak Ping Delay Selection Request SRQ/cloakh - FSK Responses . 75
7.11 Power Control Profile Values . 76
7.12 Power Control Profile Selection Request FSK Responses . 76
7.13 Cloak Detect Ping Delay Selection Request FSK Responses . 77
7.14 Proprietary Specific Parameters Request FSK Responses . 78
7.15 PRx Get Request Types . 79
7.16 Simultaneous Auxiliary Data Transport - SADT FSK Responses . 81
- 10 - IEC 63563-11:2025 © IEC 2025
7.17 PRx Simultaneous Data Stream Response Type . 82
7.18 Simultaneous Auxiliary Data Control Request Field . 83
7.19 Simultaneous Auxiliary Data Control Parameter Field . 83
7.20 Report ID Field. 84
7.21 Report [PRx Identification] FSK Responses . 85
7.22 PLA FSK Responses . 86
7.23 Received Power Parameters FSK Responses . 87
7.24 PRx Capabilities Packet FSK Responses . 89
7.25 MPP PTX FSK Packets . 90
7.26 PTx Error Status Codes . 91
7.27 PTx End Of Power Reason Codes . 92
7.28 PTx Regulation Control Status Values . 93
7.29 PTx Charge Status Values . 94
7.30 PTx Get Request Fields . 95
7.31 PTx Simultaneous Data Stream Response Type . 99
7.32 PTx Power Limit Reason Code . 104
Introduction
1.1 Overview
Magnetic power profile (MPP) is a protocol extension that provides additional messages, new power
states/modes, new power transfer contract elements, and aims to provide the following functionalities:
• Operating Frequency Negotiation
• Cloaking (Power Pause)
• Generic Information Exchange
• Simultaneous Data Stream Transactions
• Fast PTx to PRx communication
• Maximum Power and Power Control Profiles Determination
• Extended Power Negotiation
• Extended PTx/PRx Identification and Capabilities
• Extended Control Error Packets and Received Power Packets
• Power Transmitter Battery Level Reporting
• Ecosystem Scalability
A summary of differences between Magnetic Power Profile and EPP is listed below in Table 1.1.
MPP extension allows devices to operate under Restricted mode (no PTx communication) at 360kHz without
performing any explicit negotiation with the Power Transmitter. This flexibility enables devices with limited
resources (e.g., devices with no FSK support) to take advantage of the frequency change feature.
- 12 - IEC 63563-11:2025 © IEC 2025
Table 1.1: MPP Specifications Departure from Qi EPP
Feature EPP MPP
PTx Handshake Message EPP FSK ACK Message MPP FSK ACK Message
(Section 2.3.1)
FSK Parameters Negotiation EPP allows FSK parameters Fixed FSK parameters
negotiation
Data Streams Single Stream Transfer Multiple Concurrent Transfer
Foreign Object Detection FOD Packet, Calibration, RP Replaced with MPP Power Loss
Accounting Packet
Magnetic Power Profile
2.1 Overview
This chapter describes the Power Receiver and Power Transmitter requirements for Magnetic Power Profile
and the modes devices may use to communicate.
MPP supports two protocol modes:
1. Restricted Mode: One-way communication (PRx to PTx) with limited power levels (5W PRECT) using Qi
Baseline Protocol
2. Full Mode: Supports bi-directional communication and enables negotiation of higher power levels
2.1.1 Restricted Mode
MPP Restricted mode allows PRx to establish a charging session with PTx using one-way communication
(PRx to PTx) at 360kHz operating frequency using Qi Baseline Protocol.
PTx and PRx shall follow the Qi Baseline Protocol specifications when operating in Restricted mode.
(Informative)
MPP Restricted mode can be used when PRx is operating under a constrained environment e.g., device is fully
discharged
PRx is allowed to transition from MPP Restricted to MPP Full mode to enable bi-directional communication
and higher power levels. Refer to Section 4.6 for more details on how to perform the transition.
2.1.2 Full Mode
MPP Full mode enables a charging session with bi-directional communication between PTx and PRx allowing
devices to perform more complex operations such as exchange of identification information, devices
capabilities, ecosystem scalability coefficients, power negotiation and perform authentication.
In MPP Full mode, devices may transition between different protocol phases such as Negotiation, Power
Transfer, Cloak and are able to negotiate higher power levels compared to Restricted mode.
MPP Full mode is based on Qi Extended Power Profile (EPP) protocol. PTx and PRx shall follow the Qi EPP
specifications when operating in this mode. Changes to the EPP specifications are explicitly stated in this
document.
- 14 - IEC 63563-11:2025 © IEC 2025
Changes to specifications include:
1. Added MPP Power Transfer Contract Elements and removed support for EPP RP (Received Power)
contract elements
2. Added MPP data packets and removed support for EPP FOD data packets
3. Overriding time parameters
2.2 Power Receiver Requirements
MPP ASK specification is based on Qi EPP, all the timing requirements/specifications specified by Extended
Power Profile apply to MPP.
All standard Qi packets used in MPP follow the Qi specifications. Changes to the handling or the definition of
the packets are explicitly stated in this document.
2.2.1 Amplitude Shift Keying (ASK)
MPP follows the Qi ASK specifications.
2.2.2 Startup Behavior
An MPP-compatible Power Receiver shall start by sending the following sequence of packets during the
ping/configuration phase.
1. Signal Strength (SIG)
2. Identification (ID)
3. Extended Identification (XID)
4. Power Control Hold-Off (PCH) - Optional
5. Configuration Packet (CFG)
The packets shall contain the MPP identifiers as described in this section to allow an MPP-compatible Power
Transmitter to identify the Power Receiver.
PRx PTx
SIG
ID
XID
PCH (Optional)
CFG
Figure 2.1: MPP ID/CFG Phase Packets
Signal Strength (SIG)
Power Receiver shall report the Signal Strength (SIG) data packet following the Qi specifications.
Identification (ID)
Power Receiver shall report the Identification Packet (ID) with the following parameters as shown in Figure 2.2
and Table 2.1.
b7 b6 b5 b4 b3 b2 b1 b0
Major Minor
B0
B1
PRMC
B2
Ext
B3
Random Iden;fier
B4
B5
Mfg Rsvd
B6
Figure 2.2: MPP ID Packet Structure
Table 2.1: MPP ID Packet Parameters
Field Value
Major Version 2
Minor Version 0
Manufacturer Code (PRMC) Assigned PRMC code
Ext 1
Random Identifier Follows Random Device Identifier Policy
Mfg Reserved Reserved for Manufacturer’s use (Proprietary)
Refer to Qi Communications Protocol section 8.11 for more information on Random Device Identifier policy
Extended Identification (XID)
Power Receiver shall report the MPP-Extended Identification Packet (XID) to advertise MPP support. Detailed
packet definition is described in section 7.1.20.
b7 b6 b5 b4 b3 b2 b1 b0
0xFE
B0
Restricted Mfg Rsvd
B1
Mfg Rsvd
B2
VRECT
B3
Alpha0 Rx
B4
Alpha1 Rx
B5
Alpha-Kth Rx
B6
Mfg Rsvd
B7
Figure 2.3: MPP XID Packet Parameters
Power receiver may choose to advertise MPP-compatibility and operate under MPP restricted mode by
setting the Restricted bit as described in Section 7.1.20. Otherwise, the Power Receiver may request to
operate under MPP Full mode by setting the Restricted bit to zero.
- 16 - IEC 63563-11:2025 © IEC 2025
Power Receiver may choose to not advertise MPP capabilities by performing one of the following:
1. Setting the (XID Sub Header) field to any value other than 0xFE
2. Skipping XID packet, and setting Ext bit to 0 in ID packet
Power Control Hold-Off (PCH) - Optional
Power receiver may choose to operate in Restricted mode and later switch to MPP full mode. This transition
requires the Power Receiver to report PCH packet during the configuration phase.
Refer to Section 4.6 for more details on value selection.
Configuration (CFG)
Power Receiver shall report the Configuration (CFG) packet according to the Qi specifications.
2.2.3 Profile Activation
Depending on the selected operating mode in XID packet (Section 2.2.2), Power Receiver shall proceed as
follows:
1. MPP - Restricted: PRx shall proceed to Restricted Power Transfer Phase at 360kHz (Follows Qi
Baseline Protocol)
2. MPP - Full: PRx shall enable the FSK decoder, depending on the decoding result:
a) FSK MPP Pattern: PRx shall proceed to MPP Negotiation Phase (Section 3)
b) FSK NAK Pattern: PRx shall proceed to MPP Negotiation Phase with MPP error status (Section 3)
c) Timeout / Else: PRx shall proceed according to the Qi specifications (BPP/EPP)
1. FSK pattern response to Configuration (CFG) packets is always transmitted using the default 512
switching cycles.
2. Refer to MPP System Specifications - Communications Physical Layer: FSK (Section 6.2) for more
information on FSK parameters.
Figure 2.4 summarizes the flow.
Ping Phase
(any frequency)
Send
Signal Strength
Identification packet
PRx supports
Proceed as non-MPP
No
MPP ? Qi v1.x PRx
Yes
Send MPP Compatible
XID
Optional: Send PCH
Data Packet
Send Configuration
Packet
Proceed to MPP-
MPP-Restricted Active Frequency
Yes Yes Restricted Power
mode ? is 360kHz ?
Transfer Phase
No No
Proceed to BPP
Power Transfer
Phase
MPP/NAK
Proceed as non-MPP
FSK Pattern
Timeout / ACK
Qi v1.x PRx
Detected ?
May proceed as a BPP/EPP PRx
Yes
Proceed to MPP
Negotiation Phase
Figure 2.4: MPP Power Receiver Configuration Phase Decision Tree
- 18 - IEC 63563-11:2025 © IEC 2025
2.3 Power Transmitter Requirements
MPP FSK specification is based on Qi EPP, all the timing requirements/specifications specified by Extended
Power Profile apply to MPP. Updated parameters are explicitly stated in this document.
2.3.1 Frequency Shift Keying (FSK)
Magnetic Power Profile v1.x defines fixed FSK parameters:
Table 2.2: MPP FSK Parameters
Parameter Value Notes
Switching Cycles 512 / 128 FSK 512 switching cycles is only
...












Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.
Loading comments...