SIST EN ISO 4098:2018
(Main)Leather - Chemical tests - Determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter (ISO 4098:2018)
Leather - Chemical tests - Determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter (ISO 4098:2018)
ISO 4098 | IULTCS/IUC 6:2018 specifies a method of determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter.
ISO 4098 | IULTCS/IUC 6:2018 is applicable to all leather types. The result obtained by this analysis depends on factors such as:
- the degree to which the leather is ground;
- the extraction temperature;
- the extraction period;
- the ratio of leather to water.
To obtain comparable results, it is consequently imperative that test conditions be accurately reproduced.
In all cases, any ammonium salts in the filtrate are included as part of the water-soluble matter and are then decomposed on ignition. Thus they contribute towards the result for water-soluble organic substances. The concentration of the ammonium salts can be determined in the filtrate separately if required.
Leder - Chemische Prüfungen - Bestimmung wasserlöslicher Substanzen, wasserlöslicher anorganischer Substanzen und wasserlöslicher organischer Substanzen (ISO 4098:2018)
Diese Internationale Norm legt ein Verfahren zur Bestimmung wasserlöslicher Substanzen, wasserlöslicher anorganischer Substanzen und wasserlöslicher organischer Substanzen fest.
Dieses Verfahren gilt für alle Lederarten. Das durch diese Untersuchung erhaltene Ergebnis hängt von Faktoren ab, wie zum Beispiel:
dem Grad, bis zu dem das Leder zerkleinert wird;
der Extraktionstemperatur;
der Extraktionsdauer;
dem Leder-Wasser-Verhältnis.
Zum Erhalt vergleichbarer Ergebnisse ist es folglich zwingend erforderlich, dass die Bedingungen stets genau gleich sind.
In jedem Fall werden in dem Filtrat vorhandene Ammoniumsalze als Teil der wasserlöslichen Substanz einbezogen und anschließend beim Glühen zersetzt. Auf diese Weise tragen sie zum Ergebnis der wasserlöslichen organischen Substanzen bei. Die Konzentration an Ammoniumsalzen kann, sofern gefordert, in dem Filtrat getrennt bestimmt werden.
Cuir - Essais chimiques - Dosage des matières solubles dans l'eau, des matières inorganiques solubles dans l'eau et des matières organiques solubles dans l'eau (ISO 4098:2018)
ISO 4098 | IULTCS/IUC 6:2018 spécifie une méthode de dosage des matières solubles dans l'eau, des matières inorganiques solubles dans l'eau et des matières organiques solubles dans l'eau.
Cette méthode est applicable à tous les types de cuir. Le résultat obtenu lors de ce dosage dépend de facteurs tels que:
- le degré de broyage du cuir;
- la température d'extraction;
- la durée de l'extraction;
- la teneur en humidité du cuir.
Par conséquent, pour obtenir des résultats comparables, il est impératif d'utiliser des conditions d'essai exactement identiques.
Dans tous les cas, les sels d'ammonium éventuellement présents dans le filtrat sont pris en compte lors du dosage des matières solubles dans l'eau, ils sont ensuite décomposés lors de la combustion. Ils contribuent ainsi au résultat obtenu pour la teneur en matières organiques solubles dans l'eau. La concentration des sels d'ammonium dans le filtrat peut être déterminée séparément si nécessaire.
Usnje - Kemijski preskusi - Določevanje v vodi topnih snovi, v vodi topnih anorganskih snovi in v vodi topnih organskih snovi (ISO 4098:2018)
Ta dokument podaja metodo za določevanje v vodi topnih snovi, v vodi topnih anorganskih snovi in v vodi topnih organskih snovi.
Uporablja se za vse vrste usnja. Rezultat, pridobljen na podlagi te analize, je odvisen od naslednjih dejavnikov:
– stopnja, do katere je usnje zmleto;
– temperatura izločanja;
– čas izločanja;
– razmerje med usnjem in vodo.
Za pridobitev primerljivih rezultatov je zato zelo pomembno, da so preskusni pogoji natančno ponovljeni.
V vsakem primeru so amonijeve soli v filtratu vključene kot del v vodi topnih snovi, ki se nato razgradijo ob vžigu. Tako prispevajo k rezultatu v vodi topnih organskih snovi. Po potrebi je koncentracijo amonijevih soli mogoče določiti ločeno od filtrata.
General Information
- Status
- Published
- Public Enquiry End Date
- 02-Mar-2017
- Publication Date
- 11-Sep-2018
- Technical Committee
- IUSN - Leather
- Current Stage
- 6060 - National Implementation/Publication (Adopted Project)
- Start Date
- 29-Aug-2018
- Due Date
- 03-Nov-2018
- Completion Date
- 12-Sep-2018
Relations
- Effective Date
- 01-Oct-2018
- Effective Date
- 09-Feb-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
- Effective Date
- 28-Jan-2026
Overview
EN ISO 4098:2018 (IULTCS/IUC 6:2018) specifies a laboratory method for the determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter in leather. The method is applicable to all leather types and is intended to produce comparable and reproducible results when test conditions are carefully reproduced.
The principle is straightforward: a prepared, dichloromethane-extracted leather sample is subjected to aqueous extraction under defined conditions. A measured aliquot of the filtrate is evaporated and dried to obtain the total water-soluble residue; sulfation and ignition (ash at about 700 °C) yield the water-soluble inorganic matter. The water-soluble organic matter is obtained by difference.
Key procedural elements from the standard include:
- Extraction of a ground, pre-treated sample with (500 ± 10) ml deionized water at (23.5 ± 3.5) °C.
- Mechanical shaking at (50 ± 10) cycles/min for (120 ± 10) min.
- Filtration and analysis of 50 ml aliquots of filtrate.
- Drying residues at (102 ± 2) °C and ashing at about 700 °C for inorganic fraction determination.
- Inclusion of ammonium salts in the water-soluble matter (they decompose on ignition; concentration may be determined separately if required).
Key Topics
- Sample preparation: grind and prepare samples in accordance with ISO 4044 and sample location per ISO 2418.
- Reagents and water quality: use deionized/distilled water complying with ISO 3696 (Grade 3) and 1 mol/l sulfuric acid for sulfating.
- Critical variables: degree of grinding, extraction temperature, extraction period and leather-to-water ratio - all must be controlled for comparable results.
- Apparatus: wide-neck flasks, shaking apparatus, evaporating basins, oven (102 ± 2 °C), muffle furnace (~700 °C), analytical balance (0.001 g).
Applications
This method supports practical applications such as:
- Quality control (QC) of incoming hides, processed leathers and finished goods.
- Process control and optimization in tanning and finishing operations.
- Supplier conformity checks and specification verification.
- R&D and formulation work to assess soluble additives or residues.
- Regulatory and environmental reporting where quantification of soluble organics/inorganics is required.
Related Standards
Relevant referenced standards (normative in EN ISO 4098:2018) include:
- ISO 2418 - sampling location for leather
- ISO 3696 - water for analytical laboratory use
- ISO 4048 - extraction with dichloromethane and free fatty acid content
- ISO 4044 - preparation of chemical test samples
- ISO 4684 - determination of moisture (dry substance basis)
Following EN ISO 4098:2018 ensures consistent, reproducible measurement of water-soluble fractions in leather, improving comparability across laboratories and supporting robust product quality and compliance programs.
Get Certified
Connect with accredited certification bodies for this standard

Control Union Certifications
Global certification for agriculture and sustainability.
Hohenstein Institut
Textile testing and certification.

Bureau Veritas Bangladesh
Bureau Veritas certification services in Bangladesh.
Sponsored listings
Frequently Asked Questions
SIST EN ISO 4098:2018 is a standard published by the Slovenian Institute for Standardization (SIST). Its full title is "Leather - Chemical tests - Determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter (ISO 4098:2018)". This standard covers: ISO 4098 | IULTCS/IUC 6:2018 specifies a method of determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter. ISO 4098 | IULTCS/IUC 6:2018 is applicable to all leather types. The result obtained by this analysis depends on factors such as: - the degree to which the leather is ground; - the extraction temperature; - the extraction period; - the ratio of leather to water. To obtain comparable results, it is consequently imperative that test conditions be accurately reproduced. In all cases, any ammonium salts in the filtrate are included as part of the water-soluble matter and are then decomposed on ignition. Thus they contribute towards the result for water-soluble organic substances. The concentration of the ammonium salts can be determined in the filtrate separately if required.
ISO 4098 | IULTCS/IUC 6:2018 specifies a method of determination of water-soluble matter, water-soluble inorganic matter and water-soluble organic matter. ISO 4098 | IULTCS/IUC 6:2018 is applicable to all leather types. The result obtained by this analysis depends on factors such as: - the degree to which the leather is ground; - the extraction temperature; - the extraction period; - the ratio of leather to water. To obtain comparable results, it is consequently imperative that test conditions be accurately reproduced. In all cases, any ammonium salts in the filtrate are included as part of the water-soluble matter and are then decomposed on ignition. Thus they contribute towards the result for water-soluble organic substances. The concentration of the ammonium salts can be determined in the filtrate separately if required.
SIST EN ISO 4098:2018 is classified under the following ICS (International Classification for Standards) categories: 59.140.30 - Leather and furs. The ICS classification helps identify the subject area and facilitates finding related standards.
SIST EN ISO 4098:2018 has the following relationships with other standards: It is inter standard links to SIST EN ISO 4098:2006, SIST ISO 3696:1995, SIST EN 1457-1:2012, SIST EN 4530-002:2024, SIST-TP CEN ISO/TR 20879:2007. Understanding these relationships helps ensure you are using the most current and applicable version of the standard.
SIST EN ISO 4098:2018 is available in PDF format for immediate download after purchase. The document can be added to your cart and obtained through the secure checkout process. Digital delivery ensures instant access to the complete standard document.
Standards Content (Sample)
SLOVENSKI STANDARD
01-oktober-2018
1DGRPHãþD
SIST EN ISO 4098:2006
8VQMH.HPLMVNLSUHVNXVL'RORþHYDQMHYYRGLWRSQLKVQRYLYYRGLWRSQLK
DQRUJDQVNLKVQRYLLQYYRGLWRSQLKRUJDQVNLKVQRYL,62
Leather - Chemical tests - Determination of water-soluble matter, water-soluble inorganic
matter and water-soluble organic matter (ISO 4098:2018)
Leder - Chemische Prüfungen - Bestimmung wasserlöslicher Substanzen,
wasserlöslicher anorganischer Substanzen und wasserlöslicher organischer Substanzen
(ISO 4098:2018)
Cuir - Essais chimiques - Dosage des matières solubles dans l'eau, des matières
inorganiques solubles dans l'eau et des matières organiques solubles dans l'eau (ISO
4098:2018)
Ta slovenski standard je istoveten z: EN ISO 4098:2018
ICS:
59.140.30 Usnje in krzno Leather and furs
2003-01.Slovenski inštitut za standardizacijo. Razmnoževanje celote ali delov tega standarda ni dovoljeno.
EN ISO 4098
EUROPEAN STANDARD
NORME EUROPÉENNE
July 2018
EUROPÄISCHE NORM
ICS 59.140.30 Supersedes EN ISO 4098:2006
English Version
Leather - Chemical tests - Determination of water-soluble
matter, water-soluble inorganic matter and water-soluble
organic matter (ISO 4098:2018)
Cuir - Essais chimiques - Dosage des matières solubles Leder - Chemische Prüfungen - Bestimmung
dans l'eau, des matières inorganiques solubles dans wasserlöslicher Substanzen, wasserlöslicher
l'eau et des matières organiques solubles dans l'eau anorganischer Substanzen und wasserlöslicher
(ISO 4098:2018) organischer Substanzen (ISO 4098:2018)
This European Standard was approved by CEN on 23 March 2018.
CEN members are bound to comply with the CEN/CENELEC Internal Regulations which stipulate the conditions for giving this
European Standard the status of a national standard without any alteration. Up-to-date lists and bibliographical references
concerning such national standards may be obtained on application to the CEN-CENELEC Management Centre or to any CEN
member.
This European Standard exists in three official versions (English, French, German). A version in any other language made by
translation under the responsibility of a CEN member into its own language and notified to the CEN-CENELEC Management
Centre has the same status as the official versions.
CEN members are the national standards bodies of Austria, Belgium, Bulgaria, Croatia, Cyprus, Czech Republic, Denmark, Estonia,
Finland, Former Yugoslav Republic of Macedonia, France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania,
Luxembourg, Malta, Netherlands, Norway, Poland, Portugal, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland,
Turkey and United Kingdom.
EUROPEAN COMMITTEE FOR STANDARDIZATION
COMITÉ EUROPÉEN DE NORMALISATION
EUROPÄISCHES KOMITEE FÜR NORMUNG
CEN-CENELEC Management Centre: Rue de la Science 23, B-1040 Brussels
© 2018 CEN All rights of exploitation in any form and by any means reserved Ref. No. EN ISO 4098:2018 E
worldwide for CEN national Members.
Contents Page
European foreword . 3
European foreword
This document (EN ISO 4098:2018) has been prepared by Technical Committee IULTCS "International
Union of Leather Technologists and Chemists Societies" in collaboration with Technical Committee
CEN/TC 289 “Leather” the secretariat of which is held by UNI.
This European Standard shall be given the status of a national standard, either by publication of an
identical text or by endorsement, at the latest by January 2019, and conflicting national standards shall
be withdrawn at the latest by January 2019.
Attention is drawn to the possibility that some of the elements of this document may be the subject of
patent rights. CEN shall not be held responsible for identifying any or all such patent rights.
This document supersedes EN ISO 4098:2006.
According to the CEN-CENELEC Internal Regulations, the national standards organizations of the
following countries are bound to implement this European Standard: Austria, Belgium, Bulgaria,
Croatia, Cyprus, Czech Republic, Denmark, Estonia, Finland, Former Yugoslav Republic of Macedonia,
France, Germany, Greece, Hungary, Iceland, Ireland, Italy, Latvia, Lithuania, Luxembourg, Malta,
Netherlands, Norway, Poland, Portugal, Romania, Serbia, Slovakia, Slovenia, Spain, Sweden, Switzerland,
Turkey and the United Kingdom.
Endorsement notice
The text of ISO 4098:2018 has been approved by CEN as EN ISO 4098:2018 without any modification.
INTERNATIONAL ISO
STANDARD 4098
IULTCS - IUC 6
Second edition
2018-02
Leather — Chemical tests —
Determination of water-soluble
matter, water-soluble inorganic matter
and water-soluble organic matter
Cuir — Essais chimiques — Dosage des matières solubles dans
l'eau, des matières inorganiques solubles dans l'eau et des matières
organiques solubles dans l'eau
Reference numbers
ISO 4098:2018(E)
IULTCS - IUC 6:2018(E)
©
ISO 2018
ISO 4098:2018(E)
IULTCS - IUC 6:2018(E)
© ISO 2018
All rights reserved. Unless otherwise specified, or required in the context of its implementation, no part of this publication may
be reproduced or utilized otherwise in any form or by any means, electronic or mechanical, including photocopying, or posting
on the internet or an intranet, without prior written permission. Permission can be requested from either ISO at the address
below or ISO’s member body in the country of the requester.
ISO copyright office
CP 401 • Ch. de Blandonnet 8
CH-1214 Vernier, Geneva
Phone: +41 22 749 01 11
Fax: +41 22 749 09 47
Email: copyright@iso.org
Website: www.iso.org
Published in Switzerland
ii © ISO 2018 – All rights reserved
ISO 4098:2018(E)
IULTCS - IUC 6:2018(E)
Contents Page
Foreword .iv
1 Scope . 1
2 Normative references . 1
3 Terms and definitions . 1
4 Principle . 2
5 Reagents . 2
6 Apparatus . 2
7 Sampling and preparation of samples . 3
8 Procedure. 3
8.1 General . 3
8.2 Water-soluble matter . 3
8.3 Water-soluble inorganic matter . 3
9 Remarks on the procedure . 3
10 Calculation and expression of results . 4
11 Test report . 4
12 Repeatability . 5
ISO 4098:2018(E)
IULTCS - IUC 6:2018(E)
Foreword
ISO (the International Organization for Standardization) is a worldwide federation of national standards
bodies (ISO member bodies). The work of preparing International Standards is normally carried out
through ISO technical committees. Each member body interested in a subject for which a technical
committee has been established has the right to be represented on that committee. International
organizations, governmental and non-governmental, in liaison with ISO, also take part in the work.
ISO collaborates closely with the International Electrotechnical Commission (IEC) on all matters of
electrotechnical standardization.
The procedures used to develop this document and those intended for its further maintenance are
described in the ISO/IEC Directives, Part 1. In particular the different approval criteria needed for the
different types of ISO documents should be noted. This document was drafted in accordance with the
editorial rules of the ISO/IEC Directives, Part 2 (see www .iso .org/ directives).
Attention is drawn to the possibility that some of the elements of this document may be the subject of
patent rights. ISO shall not be held responsible for identifying any or all such patent rights. Details of
any patent rights identified during the development of the document will be in the Introduction and/or
on the ISO list of patent declarations received (see www .iso .org/ patents).
Any trade name used in this document is information given for the convenience of users and does not
constitute an endorsement.
For an explanation on the voluntary nature of standards, the meaning of ISO specific terms and
expressions related to conformity assessment, as well as informati
...




Questions, Comments and Discussion
Ask us and Technical Secretary will try to provide an answer. You can facilitate discussion about the standard in here.
Loading comments...